Granted Patent B2

US 12,630,635 · App. 18/057,465 · Granted May 19, 2026

Inventors: Marcin Kowanetz (San Francisco, CA); Hartmut Koeppen (San Mateo, CA); Zachary Boyd (Oakland, CA); Zhiming Liao (Livermore, CA); Yifei Zhu (San Jose, CA); Bharathi Vennapusa (Tucson, AZ); Patrick C. Roche (Tucson, AZ)

Assignee: Ventana Medical Systems, Inc.

C07K16/2827A61K39/3955A61K45/06C07K14/70532G01N33/53G01N33/5758A61N2005/1021C07K2317/34C07K2317/54C07K2317/55C07K2317/622C07K2317/76C07K2319/30G01N2500/10G01N2800/52

Abstract

Claims (51)

1 . An isolated nucleic acid encoding an antibody heavy chain variable domain (VH), wherein the VH comprises the following hypervariable regions (HVR-Hs):

(a) an HVR-H1 comprising the amino acid sequence of SNGLT (SEQ ID NO: 2);

(b) an HVR-H2 comprising the amino acid sequence of TINKDASAYYASWAKG (SEQ ID NO: 3); and

(c) an HVR-H3 comprising the amino acid sequence of IAFKTGTSI (SEQ ID NO: 4).

2 . The isolated nucleic acid of claim 1 , wherein the VH further comprises the following heavy chain variable domain framework regions (FR-Hs):

(d) FR-H1 comprising the amino acid sequence of QSLEESGGRLVKPDETLTITCTVSGIDLS (SEQ ID NO: 5);

(e) FR-H2 comprising the amino acid sequence of WVRQAPGEGLEWIG (SEQ ID NO: 6);

(f) FR-H3 comprising the amino acid sequence of RLTISKPSSTKVDLKITSPTTEDTATYFCGR (SEQ ID NO: 7); and

(g) FR-H4 comprising the amino acid sequence of WGPGTLVTVSS (SEQ ID NO: 8).

3 . The isolated nucleic acid of claim 1 , wherein the VH comprises an amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 16.

4 . The isolated nucleic acid of claim 1 , wherein the VH comprises SEQ ID NO: 16.

5 . A vector comprising the isolated nucleic acid of claim 1 .

6 . A host cell comprising the vector of claim 5 .

7 . An isolated nucleic acid encoding an antibody light chain variable domain (VL), wherein the VL comprises the following hypervariable regions (HVR-Ls):

(a) an HVR-L1 comprising the amino acid sequence of QASESVYSNNYLS (SEQ ID NO: 9);

(b) an HVR-L2 comprising the amino acid sequence of LASTLAS (SEQ ID NO: 10); and

(c) an HVR-L3 comprising the amino acid sequence of IGGKSSSTDGNA (SEQ ID NO: 11).

8 . The isolated nucleic acid of claim 7 , wherein the VL further comprises light chain variable domain framework regions (FR-Ls):

(d) FR-L1 comprising the amino acid sequence of AIVMTQTPSPVSAAVGGTVTINC (SEQ ID NO: 12);

(e) FR-L2 comprising the amino acid sequence of WFQQKPGQPPKLLIY (SEQ ID NO: 13);

(f) FR-L3 comprising the amino acid sequence of GVPSRFKGSGSGTQFTLTISGVQCDDAATYYC (SEQ ID NO: 14); and

(g) FR-L4 comprising the amino acid sequence of FGGGTEVVVR (SEQ ID NO: 15).

9 . The isolated nucleic acid of claim 7 , wherein the VL comprises an amino acid sequence having at least 95% sequence identity to SEQ ID NO: 17.

10 . The isolated nucleic acid of claim 7 , wherein the VL comprises SEQ ID NO: 17.

11 . A vector comprising the isolated nucleic acid of claim 7 .

12 . A host cell comprising the vector of claim 11 .

13 . An isolated nucleic acid encoding an antibody heavy chain variable domain (VH) and an antibody light chain variable domain (VL), wherein:

the VH comprises the following heavy chain hypervariable regions (HVR-Hs):

(a) an HVR-H1 comprising the amino acid sequence of SNGLT (SEQ ID NO: 2);

(b) an HVR-H2 comprising the amino acid sequence of TINKDASAYYASWAKG (SEQ ID NO: 3); and

(c) an HVR-H3 comprising the amino acid sequence of IAFKTGTSI (SEQ ID NO: 4); and

the VL comprises the following light chain hypervariable regions (HVR-Ls):

(d) an HVR-L1 comprising the amino acid sequence of QASESVYSNNYLS (SEQ ID NO: 9);

(e) an HVR-L2 comprising the amino acid sequence of LASTLAS (SEQ ID NO: 10); and

(f) an HVR-L3 comprising the amino acid sequence of IGGKSSSTDGNA (SEQ ID NO: 11).

14 . The isolated nucleic acid of claim 13 , wherein the VH further comprises the following heavy chain variable domain framework regions (FR-Hs):

(g) FR-H1 comprising the amino acid sequence of QSLEESGGRLVKPDETLTITCTVSGIDLS (SEQ ID NO: 5);

(h) FR-H2 comprising the amino acid sequence of WVRQAPGEGLEWIG (SEQ ID NO: 6);

(i) FR-H3 comprising the amino acid sequence of RLTISKPSSTKVDLKITSPTTEDTATYFCGR (SEQ ID NO: 7); and

(j) FR-H4 comprising the amino acid sequence of WGPGTLVTVSS (SEQ ID NO: 8).

15 . The isolated nucleic acid of claim 13 , wherein the VH comprises an amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 16.

16 . The isolated nucleic acid of claim 13 , wherein the VH comprises SEQ ID NO: 16.

17 . The isolated nucleic acid of claim 13 , wherein the VL further comprises the following light chain variable domain framework regions (FR-Ls):

(k) FR-L1 comprising the amino acid sequence of AIVMTQTPSPVSAAVGGTVTINC (SEQ ID NO: 12);

(l) FR-L2 comprising the amino acid sequence of WFQQKPGQPPKLLIY (SEQ ID NO: 13);

(m) FR-L3 comprising the amino acid sequence of GVPSRFKGSGSGTQFTLTISGVQCDDAATYYC (SEQ ID NO: 14); and

(n) FR-L4 comprising the amino acid sequence of FGGGTEVVVR (SEQ ID NO: 15).

18 . The isolated nucleic acid of claim 13 , wherein the VL comprises an amino acid sequence having at least 95% sequence identity to SEQ ID NO: 17.

19 . The isolated nucleic acid of claim 13 , wherein the VL comprises SEQ ID NO: 17.

20 . A vector comprising the isolated nucleic acid of claim 13 .

21 . A host cell comprising the vector of claim 20 .

Continuity (5)

References Cited (305)