IP Library Granted Patent US 9,676,868
Granted Patent B2
US 9,676,868 · App. 14/033,175 · Granted Jun 13, 2017

Humanized anti-factor D antibodies and uses thereof

Inventors: Arthur Huang (Oakland, CA); Robert Kelley (San Bruno, CA); Henry Lowman (El Granada, CA); Menno Van Lookeren Campagne (San Francisco, CA); Charles Winter (Belmont, CA)
Assignee: GENENTECH, INC.
C07K16/40C07K16/18A61K2039/505C07K2317/14C07K2317/24C07K2317/55C07K2317/56C07K2317/565C07K2317/567C07K2317/76C07K2317/92
View Patent ↗
Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US 9,676,868
App. No.
14/033,175
Granted
Jun 13, 2017
Kind
B2
Abstract

The invention relates to anti-Factor D antibodies, their nucleic acid and amino acid sequences, the cells and vectors that harbor these antibodies and their production and their use in the preparation of compositions and medicaments for treatment of diseases and disorders associated with excessive or uncontrolled complement activation. These antibodies are useful for diagnostics, prophylaxis and treatment of disease.

Claims (45)

1. A method for treating a complement-associated ocular disease, comprising administering to a patient in need thereof a therapeutically effective amount of an anti-Factor D antibody or an antigen-binding fragment thereof, wherein the anti-Factor D antibody or antigen-binding fragment thereof comprises:

(a) a light chain variable domain comprising: (1) light chain HVR-1 (HVR-L1) comprising the sequence ITSTDIDDDMN (SEQ ID NO: 30) or a sequence that differs from SEQ ID NO: 30 by one or more amino acid substitutions, wherein said one or more substitutions are substitution of the amino acid residue at position 10 of SEQ ID NO: 30 to L or I and/or substitution of the amino acid at position 11 of SEQ ID NO: 30 to A or Q, (2) light chain HVR-2 (HVR-L2) comprising the sequence GGNTLRP (SEQ ID NO: 35) or a sequence that differs from SEQ ID NO: 35 by one amino acid substitution, wherein said one substitution is substitution of the amino acid residue at position 3 of SEQ ID NO: 35 to S or A, and, (3) light chain HVR-3 (HVR-L3) comprising the sequence LQSDSLPYT (SEQ ID NO: 38); and

(b) a heavy chain variable domain comprising: (1) heavy chain HVR-1 (HVR-H1) comprising the sequence GYTFTNYGMN (SEQ ID NO: 39), (2) heavy chain HVR-2 (HVR-H2) comprising the sequence WINTYTGETTYADDFKG (SEQ ID NO: 40), and (3) heavy chain HVR-3 (HVR-H3) comprising the sequence EGGVNN (SEQ ID NO: 41) or a sequence that differs from SEQ ID NO: 41 by one or more amino acid substitutions, wherein said one or more substitutions are substitution of the amino acid residue at position 5 of SEQ ID NO: 41 with A or Q and/or substitution of the amino acid residue at position 6 of SEQ ID NO: 41 with A or Q,

wherein said antibody or antigen-binding fragment thereof comprises at least one of the substitutions set forth in (a)(1), (a)(2), or (b)(3) above and/or the heavy chain variable domain comprises an E at position 1.

2. The method of claim 1 , wherein the anti-Factor D antibody or antigen-binding fragment thereof comprises an E at position 1 of the heavy chain variable domain.

3. The method of claim 2 , wherein the light chain variable domain comprises the amino acid sequence of DIQVTQSPSSLSASVGDRVTITCITSTDIDDDX 4 X 5 WYQQKPGKVPKLLISGGX 6 -TLRPGVP SRFSGSGSGTDFTLTISSLQPEDVATYYCLQSDSLPYTFGQGTKX 7 EIK (SEQ ID NO: 73), wherein X 4 is M, L or I; X 5 is N, A or Q; X 6 is N, S or A; and X 7 is L or V.

4. The method of claim 3 , wherein X 7 is V.

5. The method of claim 1 , wherein (a) the heavy chain variable domain comprises: i. an HVR-H1 comprising the amino acid sequence of SEQ ID NO: 39; ii. an HVR-H2 comprising the amino acid sequence of SEQ ID NO: 40; and iii. an HVR-H3 comprising the amino acid sequence of SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44 or SEQ ID NO: 45; and (b) the light chain variable domain comprises: iv. an HVR-L1 comprising the amino acid sequence selected from SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33 and SEQ ID NO: 34; v. an HVR-L2 comprising the amino acid sequence of SEQ ID NO: 35, SEQ ID NO: 36 or SEQ ID NO: 37; and vi. an HVR-L3 comprising the amino acid sequence of SEQ ID NO: 38.

6. The method of claim 5 , wherein the HVR-H3 comprises the amino acid sequence of SEQ ID NO: 41.

7. The method of claim 5 , wherein the HVR-L1 comprises the amino acid sequence of SEQ ID NO: 30.

8. The method of claim 5 , wherein the HVR-L2 comprises the amino acid sequence of SEQ ID NO: 35.

9. The method of claim 5 , wherein the HVR-L1 comprises the amino acid sequence of SEQ ID NO: 30, the HVR-L2 comprises the amino acid sequence of SEQ ID NO: 35, and the HVR-L3 comprises the amino acid sequence of SEQ ID NO: 38.

10. The method of claim 5 , wherein the HVR-H1 comprises the amino acid sequence of SEQ ID NO: 39, the HVR-H2 comprises the amino acid sequence of SEQ ID NO: 40, the HVR-H3 comprises the amino acid sequence of SEQ ID NO: 41, the HVR-L1 comprises the amino acid sequence of SEQ ID NO: 30, the HVR-L2 comprises the amino acid sequence of SEQ ID NO: 35, and the HVR-L3 comprises the amino acid sequence of SEQ ID NO: 38.

11. The method of claim 10 , wherein the light chain variable domain comprises the amino acid sequence of SEQ ID NO: 1, and wherein the amino acid residue at position 104 of SEQ ID NO: 1 is substituted with V.

12. The method of claim 11 , wherein the amino acid residue at position 1 of the heavy chain variable domain is an E.

13. The method of claim 1 , wherein the heavy chain variable domain comprises the sequence of SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28 or SEQ ID NO: 29.

14. The method of claim 1 , wherein the light chain variable domain comprises the sequence of SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, or SEQ ID NO: 14.

15. A method for treating a complement-associated ocular disease, comprising administering to a patient in need thereof a therapeutically effective amount of an anti-Factor D antibody or an antigen-binding fragment thereof, wherein the anti-Factor D antibody or antigen-binding fragment thereof comprises a polypeptide comprising the following amino acid sequence: X 1 QLVQSGPELKKPGASVKVSCKASGYTFTNYGMNVVVRQAPGQGLEVVMGWINTYT G ETTYADDFKGRFVFSLDTSVSTAYLQISSLKAEDTAVYYCEREGGVX 2 X 3 WGQGTLVTV S S (SEQ ID NO: 74), wherein X 1 is E; X 2 is N, A or Q; and X 3 is N, A or Q.

16. The method of claim 15 , wherein the anti-Factor D antibody or antigen-binding fragment thereof further comprises a polypeptide comprising the following amino acid sequence: DIQVTQSPSSLSASVGDRVTITCITSTDIDDDX 4 X 5 WYQQKPGKVPKLLISGG-X 6 TLRPGVP SRFSGSGSGTDFTLTISSLQPEDVATYYCLQSDSLPYTFGQGTKX 7 EIK (SEQ ID NO:73), wherein X 4 is M, L or I; X 5 is N, A or Q; X 6 is N, S or A; and X 7 is L or V.

17. A method for treating a complement-associated ocular disease, comprising administering to a patient in need thereof a therapeutically effective amount of an anti-Factor D antibody or an antigen-binding fragment thereof, wherein the anti-Factor D antibody or antigen-binding fragment thereof comprises the heavy chain variable domain sequence of SEQ ID NO: 19.

18. The method of claim 17 , wherein the anti-Factor D antibody or antibody fragment thereof further comprises the light chain variable domain sequence of SEQ ID NO: 7.

19. A method for treating a complement-associated ocular disease, comprising administering to a patient in need thereof a therapeutically effective amount of an anti-Factor D antibody or an antigen-binding fragment thereof, wherein the anti-Factor D antibody or antigen-binding fragment thereof comprises the heavy chain sequence of SEQ ID NO: 63.

20. The method of claim 19 , wherein the anti-Factor D antibody or antigen-binding fragment thereof further comprises the light chain sequence of SEQ ID NO: 61.

21. A method for treating a complement-associated ocular disease, comprising administering to a patient in need thereof a therapeutically effective amount of an anti-Factor D antibody or an antigen-binding fragment thereof, wherein the anti-Factor D antibody or antigen-binding fragment thereof comprises: (a) a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 1, wherein the amino acid residue at position 104 of SEQ ID NO: 1 is substituted with V; and (b) a heavy chain variable domain comprising an HVR-H1 comprising the amino acid sequence of SEQ ID NO: 39, an HVR-H2 comprising the amino acid sequence of SEQ ID NO: 40, and an HVR-H3 comprising the amino acid sequence of SEQ ID NO: 41, wherein the amino acid residue at position 1 of the heavy chain variable domain is an E.

22. A method for treating a complement-associated ocular disease, comprising administering to a patient in need thereof a therapeutically effective amount of an anti-Factor D antibody or an antigen-binding fragment thereof, wherein the anti-Factor D antibody or antigen-binding fragment thereof comprises:

(a) a heavy chain variable domain comprising: i. an HVR-H1 comprising the amino acid sequence of SEQ ID NO: 39; ii. an HVR-H2 comprising the amino acid sequence of SEQ ID NO: 40; and iii. an HVR-H3 comprising the amino acid sequence of SEQ ID NO: 41; and

(b) a light chain variable domain comprising: i. an HVR-L1 comprising the amino acid sequence of SEQ ID NO: 30; ii. an HVR-L2 comprising the amino acid sequence of SEQ ID NO: 35; and iii. an HVR-L3 comprising the amino acid sequence of SEQ ID NO: 38; wherein the amino acid residue at position 1 of the heavy chain variable domain is an E.

23. A method for treating a complement-associated ocular disease, comprising administering to a patient in need thereof a therapeutically effective amount of an anti-Factor D antibody or an antigen-binding fragment thereof, wherein the anti-Factor D antibody or antigen-binding fragment thereof comprises the heavy chain variable domain sequence of SEQ ID NO: 19 and the light chain variable domain sequence of SEQ ID NO: 7.

24. The method of any one of claims 1 to 23 , wherein the ocular disease is selected from the group consisting of age-related macular degeneration, diabetic retinopathy, choroidal neovascularization (CNV), uveitis, diabetic macular edema, pathological myopia, von Hippel-Lindau disease, histoplasmosis of the eye, Central Retinal Vein Occlusion (CRVO), corneal neovascularization, and retinal neovascularization.

25. The method of claim 24 , wherein the ocular disease is age-related macular degeneration.

26. The method of claim 25 , wherein the age-related macular degeneration is dry age-related macular degeneration.

27. The method of claim 26 , wherein the dry age-related macular degeneration is geographic atrophy.

28. The method of claim 24 , wherein the anti-Factor D antibody or antigen-binding fragment thereof is administered topically to the eye of the patient in an eye ointment or an eye drop solution.

29. The method of claim 24 , wherein the anti-Factor D antibody or antigen-binding fragment thereof is administered to the eye of the patient by ocular injection, intraocular injection, intravitreal injection, juxtascleral injection, subtenon injection, or superchoroidal injection.

30. The method of claim 29 , wherein the anti-Factor D antibody or antigen-binding fragment thereof is administered to the eye of the patient by intravitreal injection.

31. The method of claim 24 , wherein the anti-Factor D antibody or antigen-binding fragment thereof is administered to the patient at a dose in the range of 0.1 mg/kg to 150 mg/kg.

32. The method of claim 24 , wherein the anti-Factor D antibody or antigen-binding fragment thereof is a component of a pharmaceutical formulation.

33. A method for treating complement-associated geographic atrophy, comprising administering to a patient in need thereof a therapeutically effective amount of an anti-Factor D antibody or an antigen-binding fragment thereof, wherein the anti-Factor D antibody or antigen-binding fragment thereof comprises:

(a) a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 7; and (b) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 19; and wherein the anti-Factor D antibody or an antigen-binding fragment thereof is administered to the eye of the patient by intravitreal injection.

34. A method for treating complement-associated geographic atrophy, comprising administering to a patient in need thereof a therapeutically effective amount of an anti-Factor D antibody or an antigen-binding fragment thereof, wherein the anti-Factor D antibody or antigen-binding fragment thereof comprises:

(a) a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 1, wherein the amino acid residue at position 104 of SEQ ID NO: 1 is substituted with V; and (b) a heavy chain variable domain comprising an HVR-H1 comprising the amino acid sequence of SEQ ID NO: 39, an HVR-H2 comprising the amino acid sequence of SEQ ID NO: 40, and an HVR-H3 comprising the amino acid sequence of SEQ ID NO: 41, wherein the amino acid residue at position 1 of the heavy chain variable domain is an E; and

wherein the anti-Factor D antibody or an antigen-binding fragment thereof is administered to the eye of the patient by intravitreal injection.

35. A method for treating complement-associated geographic atrophy, comprising administering to a patient in need thereof a therapeutically effective amount of an anti-Factor D antibody or an antigen-binding fragment thereof, wherein the anti-Factor D antibody or antigen-binding fragment thereof comprises:

(a) a heavy chain variable domain comprising: i. an HVR-H1 comprising the amino acid sequence of SEQ ID NO: 39; ii. an HVR-H2 comprising the amino acid sequence of SEQ ID NO: 40; and iii. an HVR-H3 comprising the amino acid sequence of SEQ ID NO: 41; and

(b) a light chain variable domain comprising: i. an HVR-L1 comprising the amino acid sequence of SEQ ID NO: 30; ii. an HVR-L2 comprising the amino acid sequence of SEQ ID NO: 35; and iii. an HVR-L3 comprising the amino acid sequence of SEQ ID NO: 38; wherein the amino acid residue at position 1 of the heavy chain variable domain is an E; and wherein the anti-Factor D antibody or an antigen-binding fragment thereof is administered to the eye of the patient by intravitreal injection.

Assignments (1)
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Sep 20, 2013
From: HUANG, ARTHUR; KELLEY, ROBERT; LOWMAN, HENRY; VAN LOOKEREN CAMPAGNE, MENNO; WINTER, CHARLES
To: GENENTECH, INC.
Reel/Frame 031253/0408 →
Continuity (5)
Division 13591755 · Aug 22, 2012
Division 12430479 · Apr 27, 2009
Provisional Application 61048689 · Apr 29, 2008
Provisional Application 61048431 · Apr 28, 2008
Related Publication 20140065137A1 · Mar 6, 2014