IP Library › Granted Patent US 10,022,432
Granted Patent B2
US 10,022,432 · App. 15/800,975 · Granted Jul 17, 2018

Malaria antigens and methods of use

Inventors: Ping Chen (Potomac, MD); Duncan McVey (Derwood, MD); Douglas E. Brough (Gaithersburg, MD); Joseph Bruder (Gaithersburg, MD)
Assignee: GenVec, Inc.
A61K39/015A61K2039/5256A61K2039/53
View Patent ↗
Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US 10,022,432
App. No.
15/800,975
Granted
Jul 17, 2018
Kind
B2
Abstract

The invention is directed to a composition comprising one or more polypeptides or one or more nucleic acid sequences that can induce a protective immune response against Plasmodium species that infect humans. The invention also is directed to a method of using such compositions to induce a protective immune response against a Plasmodium parasite in a mammal.

Claims (35)

1. A composition comprising a pharmaceutically acceptable carrier and a vector encoding one or more isolated polypeptides, wherein each of the one or more isolated polypeptides comprises: (a) an amino acid sequence comprising at least 20 contiguous amino acid residues of the sequence MKKDREPIDEDEMRITSTGRMTNYVNYGAKILG (SEQ ID NO: 20), (b) an amino acid sequence comprising at least 20 contiguous amino acid residues of the sequence KIKATGNAIGKAVTLAEIIKRRFKGLHQIT (SEQ ID NO: 21), or (c) an amino acid sequence comprising SEQ ID NO: 22.

2. The composition of claim 1 , wherein the composition comprises an isolated polypeptide comprising at least 20 contiguous amino acid residues of the sequence MKKDREPIDEDEMRITSTGRMTNYVNYGAKILG (SEQ ID NO: 20).

3. The composition of claim 2 , wherein the composition comprises an isolated polypeptide comprising the amino acid sequence of SEQ ID NO: 20.

4. The composition of claim 1 , wherein the composition comprises an isolated polypeptide comprising at least 20 contiguous amino acid residues of the sequence KIKATGNAIGKAVTLAEIIKRRFKGLHQIT (SEQ ID NO: 21).

5. The composition of claim 4 , wherein the composition comprises an isolated polypeptide comprising the amino acid sequence of SEQ ID NO: 21.

6. The composition of claim 1 , wherein the composition comprises an isolated polypeptide comprising the amino acid sequence of SEQ ID NO: 22.

7. The composition of claim 6 , wherein the isolated polypeptide comprises the amino acid sequence of KDAGYQPPLDEKYVKEMXPEEIVN (SEQ ID NO: 23), wherein X is a serine (S) residue or a threonine (T) residue.

8. The composition of claim 1 , wherein the composition comprises a polypeptide comprising the amino acid sequence of SEQ ID NO: 24, SEQ ID NO: 25, or SEQ ID NO: 26.

9. A composition comprising a pharmaceutically acceptable carrier and a vector encoding one or more isolated polypeptides, wherein each of the one or more isolated polypeptides comprises: (a) an amino acid sequence comprising at least 20 contiguous amino acid residues of the sequence MKKDREPIDEDEMRITSTGRMTNYVNYGAKILG (SEQ ID NO: 20), (b) an amino acid sequence comprising at least 20 contiguous amino acid residues of the sequence KIKATGNAIGKAVTLAEIIKRRFKGLHQIT (SEQ ID NO: 21), and (c) an amino acid sequence comprising SEQ ID NO: 22, and wherein each of the one or more isolated polypeptides induces a protective immune response against Plasmodium falciparum and/or Plasmodium vivax in a mammal.

10. The composition of claim 9 , wherein the isolated polypeptide comprises the amino acid sequence of KDAGYQPPLDEKYVKEMXPEEIVN (SEQ ID NO: 23), wherein X is a serine (S) residue or a threonine (T) residue.

11. The composition of claim 9 , wherein one or more isolated polypeptides comprises the amino acid sequences of SEQ ID NO: 20, SEQ ID NO: 21, and SEQ ID NO: 22.

12. The composition of claim 11 , wherein the isolated polypeptide comprises the amino acid sequence of KDAGYQPPLDEKYVKEMXPEEIVN (SEQ ID NO: 23), wherein X is a serine (S) residue or a threonine (T) residue.

13. A composition comprising a pharmaceutically acceptable carrier and a vector encoding one or more polypeptides comprising the amino acid sequence of SEQ ID NO: 24.

14. A composition comprising a pharmaceutically acceptable carrier and a vector encoding one or more polypeptides comprising the amino acid sequence of SEQ ID NO: 25.

15. A composition comprising a pharmaceutically acceptable carrier and a vector encoding one or more polypeptides comprising the amino acid sequence of SEQ ID NO: 26.

16. The composition of claim 1 , wherein the vector is an adenoviral vector.

17. The composition of claim 9 , wherein the vector is an adenoviral vector.

18. The composition of claim 13 , wherein the vector is an adenoviral vector.

19. The composition of claim 14 , wherein the vector is an adenoviral vector.

20. The composition of claim 15 , wherein the vector is an adenoviral vector.

21. The composition of claim 16 , wherein the adenoviral vector is a human adenoviral vector or a gorilla adenoviral vector.

22. The composition of claim 17 , wherein the adenoviral vector is a human adenoviral vector or a gorilla adenoviral vector.

23. The composition of claim 18 , wherein the adenoviral vector is a human adenoviral vector or a gorilla adenoviral vector.

24. The composition of claim 19 , wherein the adenoviral vector is a human adenoviral vector or a gorilla adenoviral vector.

25. The composition of claim 20 , wherein the adenoviral vector is a human adenoviral vector or a gorilla adenoviral vector.

26. The composition of claim 1 , wherein each of the one or more isolated polypeptides induces a protective immune response against Plasmodium falciparum and/or Plasmodium vivax in a mammal.

27. The composition of claim 9 , wherein each of the one or more isolated polypeptides induces a protective immune response against Plasmodium falciparum and/or Plasmodium vivax in a mammal.

28. The composition of claim 13 , wherein each of the one or more isolated polypeptides induces a protective immune response against Plasmodium falciparum and/or Plasmodium vivax in a mammal.

29. The composition of claim 14 , wherein each of the one or more isolated polypeptides induces a protective immune response against Plasmodium falciparum and/or Plasmodium vivax in a mammal.

30. The composition of claim 15 , wherein each of the one or more isolated polypeptides induces a protective immune response against Plasmodium falciparum and/or Plasmodium vivax in a mammal.

31. The composition of claim 26 , wherein the mammal is a human.

32. The composition of claim 27 , wherein the mammal is a human.

33. The composition of claim 28 , wherein the mammal is a human.

34. The composition of claim 29 , wherein the mammal is a human.

35. The composition of claim 30 , wherein the mammal is a human.

Assignments (1)
PATENT SECURITY AGREEMENT Recorded Sep 3, 2025
From: PRECIGEN, INC.; GENVEC LLC; PRECIGEN ACTOBIO, INC.; EXEMPLAR GENETICS, LLC
To: BIOPHARMA CREDIT PLC, AS COLLATERAL AGENT
Reel/Frame 072828/0564 →
Continuity (3)
Division 14441988
Provisional Application 61725248 · Nov 12, 2012
Related Publication 20180153979A1 · Jun 7, 2018