IP Library › Granted Patent US 10,308,722
Granted Patent B2
US 10,308,722 · App. 15/670,811 · Granted Jun 4, 2019

Method for the treament of multiple myeloma or non-hodgkins lymphoma with anti-CD38 antibody in combination with thalidomine, lenalidomids, or pomalidomide

Inventors: Lisa Rojkjaer (Hedingen, CH); Rainer Boxhammer (Aying, DE); Jan Endell (Munich, DE); Mark Winderlich (Munich, DE); Christofer Samuelsson (Holzkirchen, DE)
Assignee: MORPHOSYS AG
C07K16/40A61K31/454A61K31/69A61K38/05A61K38/07A61K39/3955A61K39/39558A61K45/06C07K16/28C07K16/2896C07K16/3061A61K2039/505C07K2317/56C07K2317/565C07K2317/73C07K2317/732C07K2317/76
View Patent ↗
Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US 10,308,722
App. No.
15/670,811
Granted
Jun 4, 2019
Kind
B2
Abstract

The present disclosure is directed to a method of treating multiple myeloma or non-hodgkins lymphoma with a pharmaceutical composition comprising an anti-CD38 antibody in combination with thalidomide, lenalidomide, or pomalidomide.

Claims (31)

1. A method for treating multiple myeloma or non-hodgkins lymphoma in a subject in need thereof, wherein said method comprises administering to the subject a therapeutically effective amount of a combination of: (i) thalidomide, lenalidomide or pomalidomide, (ii) an antibody specific for CD38, comprising an HCDR1 region of sequence SYYMN (SEQ ID NO: 14) or GFTFSSYYMN (SEQ ID NO: 1), an HCDR2 region of sequence GISGDPSNTYYADSVKG (SEQ ID NO: 2), an HCDR3 region of sequence DLPLVYTGFAY (SEQ ID NO: 3), an LCDR1 region of sequence SGDNLRHYYVY (SEQ ID NO: 4), an LCDR2 region of sequence GDSKRPS (SEQ ID NO: 5), and an LCDR3 region of sequence QTYTGGASL (SEQ ID NO: 6).

2. The method of claim 1 , wherein said antibody comprises an HCDR1 region of sequence SYYMN (SEQ ID NO: 14).

3. The method of claim 1 , wherein said antibody comprises an HCDR1 region of sequence GFTFSSYYMN (SEQ ID NO: 1).

4. The method of claim 1 , wherein said antibody comprises a variable heavy chain of the sequence:

(SEQ ID NO: 10)

QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYYMNWVRQAPGKGLEWVSG

ISGDP

SNTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDLPLVYT

GF AYWGQGTLVTVSS;

and a variable light chain of the sequence:

(SEQ ID NO: 11)

DIELTQPPSVSVAPGQTARISCSGDNLRHYYVYWYQQKPGQAPVLVIYGD

SKRPS

GIPERFSGSNSGNTATLTISGTQAEDEADYYCQTYTGGASLVFGGGTKLT

VLGQ.

5. The method of claim 1 , wherein said antibody is an IgG antibody.

6. The method of claim 1 , wherein said antibody comprises an IgG1 Fc region.

7. The method of claim 1 , wherein said antibody comprises a modified Fc region, wherein said modification enhances ADCC activity.

8. The method of claim 1 , wherein said combination comprises said antibody and thalidomide.

9. The method of claim 8 , wherein said cancer is multiple myeloma.

10. The method of claim 1 , wherein said combination comprises said antibody and lenalidomide.

11. The method of claim 10 , wherein said cancer is multiple myeloma.

12. The method of claim 1 , wherein said combination comprises said antibody and pomalidomide.

13. The method of claim 12 , wherein said cancer is multiple myeloma.

14. The method of claim 1 , wherein said antibody and said thalidomide, lenalidomide or pomalidomide are administered separately.

15. The method of claim 12 , wherein said antibody and said thalidomide are administered separately.

16. The method of claim 12 , wherein said antibody and said lenalidomide are administered separately.

17. The method of claim 12 , wherein said antibody and said pomalidomide are administered separately.

18. A method for treating multiple myeloma or non-hodgkins lymphoma in a subject in need thereof, wherein said method comprises administering to the subject a therapeutically effective amount of a combination of: thalidomide and an antibody specific for CD38, comprising an HCDR1 region of sequence SYYMN (SEQ ID NO: 14) or GFTFSSYYMN (SEQ ID NO: 1), an HCDR2 region of sequence GISGDPSNTYYADSVKG (SEQ ID NO: 2), an HCDR3 region of sequence DLPLVYTGFAY (SEQ ID NO: 3), an LCDR1 region of sequence SGDNLRHYYVY (SEQ ID NO: 4), an LCDR2 region of sequence GDSKRPS (SEQ ID NO: 5), and an LCDR3 region of sequence QTYTGGASL (SEQ ID NO: 6).

19. A method for treating multiple myeloma or non-hodgkins lymphoma in a subject in need thereof, wherein said method comprises administering to the subject a therapeutically effective amount of a combination of: lenalidomide and an antibody specific for CD38, comprising an HCDR1 region of sequence SYYMN (SEQ ID NO: 14) or GFTFSSYYMN (SEQ ID NO: 1), an HCDR2 region of sequence GISGDPSNTYYADSVKG (SEQ ID NO: 2), an HCDR3 region of sequence DLPLVYTGFAY (SEQ ID NO: 3), an LCDR1 region of sequence SGDNLRHYYVY (SEQ ID NO: 4), an LCDR2 region of sequence GDSKRPS (SEQ ID NO: 5), and an LCDR3 region of sequence QTYTGGASL (SEQ ID NO: 6).

20. A method for treating multiple myeloma or non-hodgkins lymphoma in a subject in need thereof, wherein said method comprises administering to the subject a therapeutically effective amount of a combination of: pomalidomide and an antibody specific for CD38, comprising an HCDR1 region of sequence SYYMN (SEQ ID NO: 14) or GFTFSSYYMN (SEQ ID NO: 1), an HCDR2 region of sequence GISGDPSNTYYADSVKG (SEQ ID NO: 2), an HCDR3 region of sequence DLPLVYTGFAY (SEQ ID NO: 3), an LCDR1 region of sequence SGDNLRHYYVY (SEQ ID NO: 4), an LCDR2 region of sequence GDSKRPS (SEQ ID NO: 5), and an LCDR3 region of sequence QTYTGGASL (SEQ ID NO: 6).

Assignments (1)
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Mar 30, 2018
From: ROJKJAER, LISA, DR; BOXHAMMER, RAINER; ENDELL, JAN, DR; WINDERLICH, MARK, DR; SAMUELSSON, CHRISTOPHER, DR
To: MORPHOSYS AG
Reel/Frame 045401/0759 →
Priority Claims (1)
EP 10180485 · Sep 27, 2010 · regional
Continuity (8)
Continuation 15016330 · Feb 5, 2016
Division 14500366 · Sep 29, 2014
Continuation 13825325
Provisional Application 61486814 · May 17, 2011
Provisional Application 61468607 · Mar 29, 2011
Provisional Application 61437696 · Jan 31, 2011
Provisional Application 61386619 · Sep 27, 2010
Related Publication 20180022823A1 · Jan 25, 2018