IP Library › Granted Patent US 12,251,448
Granted Patent B2
US 12,251,448 · App. 17/244,721 · Granted Mar 18, 2025

Compositions and methods for the depletion of CD5+ cells

Inventors: Anthony Boitano (Newton, MA); Michael Cooke (Boston, MA); Rahul Palchaudhuri (Somerville, MA); Sean McDonough (Littleton, MA)
Assignee: Heidelberg Pharma Research GmbH
A61K47/6803A61K38/12A61K47/6849C07K16/2896A61K2039/505C07K2317/92
View Patent ↗
Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US 12,251,448
App. No.
17/244,721
Granted
Mar 18, 2025
Kind
B2
Abstract

The invention provides anti-CD5 antibodies, antigen-binding fragments thereof, and antibody drug conjugates thereof, for use in treating, for example, a stem cell disorder, cancer, or autoimmune disease, among other hematological and proliferative diseases. Compositions and methods for depleting populations of CD5+ cells, such as CD5+ cancer cells and CD5+ immune cells are described, and can be used to treat cancers and autoimmune diseases directly as stand-alone therapies by eradicating cancerous cells and autoreactive immune cells that express CD5 and/or to prepare a patient for hematopoietic stem cell transplantation, for instance, by depleting populations of CD5+ immune cells that cross-react with, and mount an immune response against, non-self hematopoietic stem cells.

Claims (113)

1. A method of depleting a population of CD5+ cells in a human patient, the method comprising:

administering to the human patient an effective amount of an anti-CD5 antibody 5D7 or antigen-binding fragment thereof,

wherein the antibody, or antigen-binding fragment thereof, is conjugated to a cytotoxin, to form an anti-CD5 antibody 5D7 antibody drug conjugate,

wherein the cytotoxin is an amatoxin,

wherein the anti-CD5 antibody 5D7 antibody drug conjugate has a drug to antibody ratio of about 6 or 2, wherein the conjugation is site-specific via a D265C mutation, and

wherein the antibody or antigen-binding fragment thereof conjugated to a cytotoxin is represented by the formula Ab-Z-L-Am, wherein Ab is the antibody or antigen-binding fragment thereof, L is a linker, Z is a chemical moiety, and Am is an amatoxin represented by formula (I)

wherein R 1 is H, OH, OR A , or OR C ;

R 2 is H, OH, OR B , or OR C ;

R A and R B , when present, together with the oxygen atoms to which they are bound, combine to form an 5-membered heterocycloalkyl group;

R 3 is H, R C , or R D ;

R 4 , R 5 , R 6 , and R 7 are each independently H, OH, OR C , OR D , R C , or R D ;

R 8 is OH, NH 2 , OR C , OR D , NHR C , or NR C R D ;

R 9 is H, OH, OR C , or OR D ;

X is —S—, —S(O)—, or —SO 2 —;

R C is -L-Z;

R D is C 1 -C 6 alkyl, C 1 -C 6 heteroalkyl, C 2 -C 6 alkenyl, C 2 -C 6 heteroalkenyl, C 2 -C 6 alkynyl, C 2 -C 6 heteroalkynyl, cycloalkyl, heterocycloalkyl, aryl, or heteroaryl;

L is C 1 -C 6 alkylene, C 1 -C 6 heteroalkylene, C 2 -C 6 alkenylene, C 2 -C 6 heteroalkenylene, C 2 -C 6 alkynylene, C 2 -C 6 heteroalkynylene, cycloalkylene, heterocycloalkylene, arylene, heteroarylene; a dipeptide, —C(═O)—, a peptide, or a combination thereof; and

Z is a chemical moiety formed from a coupling reaction between a reactive substituent present on L and a reactive substituent present within the antibody or antigen-binding fragment thereof,

wherein Am comprises exactly one R C substituent, and wherein said antibody or antigen-binding fragment thereof comprises the following complementarity determining regions (CDRs):

a. a CDR-H1 having the amino acid sequence GYTFTNY (SEQ ID NO: 3);

b. a CDR-H2 having the amino acid sequence NTHTGE (SEQ ID NO: 4);

c. a CDR-H3 having the amino acid sequence RGYDWYFDV (SEQ ID NO: 5);

d. a CDR-L1 having the amino acid sequence RASQDINSYLS (SEQ ID NO: 6);

e. a CDR-L2 having the amino acid sequence RANRLVD (SEQ ID NO: 7); and

f. a CDR-L3 having the amino acid sequence QQYDESPWT (SEQ ID NO: 8); or

a. a CDR-H1 having the amino acid sequence FSLSTSGMG (SEQ ID NO: 29);

b. a CDR-H2 having the amino acid sequence WWDDD (SEQ ID NO: 30);

c. a CDR-H3 having the amino acid sequence RRATGTGFDY (SEQ ID NO: 31);

d. a CDR-L1 having the amino acid sequence QDVGTA (SEQ ID NO: 32);

e. a CDR-L2 having the amino acid sequence WTSTRHT (SEQ ID NO: 33);

f. a CDR-L3 having the amino acid sequence YNSYNT (SEQ ID NO: 34).

2. A method of preventing rejection of a hematopoietic stem cell graft in a human patient in need of a hematopoietic stem cell transplant, the method comprising:

administering to the human patient an effective amount of an anti-CD5 antibody 5D7, or antigen-binding fragment thereof, prior to the human patient receiving a transplant comprising hematopoietic stem cells,

wherein the antibody, or antigen-binding fragment thereof, is conjugated to a cytotoxin, to form an anti-CD5 antibody 5D7 antibody drug conjugate,

wherein the cytotoxin is an amatoxin, and

wherein the anti-CD5 antibody 5D7 antibody drug conjugate has a drug to antibody ratio of about 6 or 2, wherein the conjugation is site-specific via a D265C mutation, and

wherein the antibody or antigen-binding fragment thereof conjugated to a cytotoxin is represented by the formula Ab-Z-L-Am, wherein Ab is the antibody or antigen-binding fragment thereof, L is a linker, Z is a chemical moiety, and Am is an amatoxin represented by formula (I)

wherein R 1 is H, OH, OR A , or OR C ;

R 2 is H, OH, OR B , or OR C ;

R A and R B , when present, together with the oxygen atoms to which they are bound, combine to form an 5-membered heterocycloalkyl group;

R 3 is H, R C , or R D ;

R 4 , R 5 , R 6 , and R 7 are each independently H, OH, OR C , OR D , R C , or R D ;

R 8 is OH, NH 2 , OR C , OR D , NHR C , or NR C R D ;

R 9 is H, OH, OR C , or OR D ;

X is —S—, —S(O)—, or —SO 2 —;

R C is -L-Z;

R D is C 1 -C 6 alkyl, C 1 -C 6 heteroalkyl, C 2 -C 6 alkenyl, C 2 -C 6 heteroalkenyl, C 2 -C 6 alkynyl, C 2 -C 6 heteroalkynyl, cycloalkyl, heterocycloalkyl, aryl, or heteroaryl;

L is C 1 -C 6 alkylene, C 1 -C 6 heteroalkylene, C 2 -C 6 alkenylene, C 2 -C 6 heteroalkenylene, C 2 -C 6 alkynylene, C 2 -C 6 heteroalkynylene, cycloalkylene, heterocycloalkylene, arylene, heteroarylene; a dipeptide, —C(═O)—, a peptide, or a combination thereof; and

Z is a chemical moiety formed from a coupling reaction between a reactive substituent present on L and a reactive substituent present within the antibody or antigen-binding fragment thereof,

wherein Am comprises exactly one R C substituent, and wherein said antibody or antigen-binding fragment thereof comprises the following complementarity determining regions (CDRs):

a. a CDR-H1 having the amino acid sequence GYTFTNY (SEQ ID NO: 3);

b. a CDR-H2 having the amino acid sequence NTHTGE (SEQ ID NO: 4);

c. a CDR-H3 having the amino acid sequence RGYDWYFDV (SEQ ID NO: 5);

d. a CDR-L1 having the amino acid sequence RASQDINSYLS (SEQ ID NO: 6);

e. a CDR-L2 having the amino acid sequence RANRLVD (SEQ ID NO: 7); and

f. a CDR-L3 having the amino acid sequence QQYDESPWT (SEQ ID NO: 8); or

a. a CDR-H1 having the amino acid sequence FSLSTSGMG (SEQ ID NO: 29);

b. a CDR-H2 having the amino acid sequence WWDDD (SEQ ID NO: 30);

c. a CDR-H3 having the amino acid sequence RRATGTGFDY (SEQ ID NO: 31);

d. a CDR-L1 having the amino acid sequence QDVGTA (SEQ ID NO: 32);

e. a CDR-L2 having the amino acid sequence WTSTRHT (SEQ ID NO: 33);

f. a CDR-L3 having the amino acid sequence YNSYNT (SEQ ID NO: 34).

3. The method of claim 1 , comprising administering a transplant comprising hematopoietic stem cells to the human patient.

4. The method of claim 1 , wherein the antibody or antigen-binding fragment thereof,

comprises a V L having the amino acid sequence DIQMTQSPSSMSASLGDRVTITCRASQDINSYLSWFQQKPGKSPKTLIYRANRL VDGVPSRFSGSGSGTDYTLTISSLQYEDFGIYYCQQYDESPWTFGGGTKLEIK (SEQ ID NO: 1); and a V H having the amino acid sequence QIQLVQSGPGLKKPGGSVRISCAASGYTFTNYGMNWVKQAPGKGLRWMGWI NTHTGEPTYADDFKGRFTFSLDTSKSTAYLQINSLRAEDTATYFCTRRGYDWY FDVWGQGTTVTVSS (SEQ ID NO: 2); or

comprises a V L having the amino acid sequence NIVMTQSPSSLSASVGDRVTITCQASQDVGTAVAWYQQKPDQSPKLLIYWTSTRHTGVP DRFTGSGS GTDFTLTISSLQPEDIATYFCHQYNSYNTFGSGTKLEIK (SEQ ID NO: 258); and a V H having the amino acid sequence QVTLKESGPVLVKPTETLTLTCTFSGFSLSTSGMGVGWIRQAPGKGLEWVAHIWWDDD VYYNPSLKSRLTITKDASKDQVSLKLSSVTAADTAVYYCVRRRATGTGFDYWGQGTLV TVSS (SEQ ID NO: 257).

5. The method of claim 1 , wherein R A and R B , together with the oxygen atoms to which they are bound, combine to form a 5 membered heterocycloalkyl group of formula:

wherein Y is —C(═O)—, —C(═S)—, —C(═NR E )—, or —C(R E R E′ )—; and

R E and R E′ are each independently C 1 -C 6 alkylene-R C , C 1 -C 6 heteroalkylene-R C , C 2 -C 6 alkenylene-R C , C 2 -C 6 heteroalkenylene-R C , C 2 -C 6 alkynylene-R C , C 2 -C 6 heteroalkynylene-R C , cycloalkylene-R C , heterocycloalkylene-R C , arylene-R C , or heteroarylene-R C .

6. The method of claim 1 , wherein:

(a) R 1 is H, OH, or OR A ;

R 2 is H, OH, or OR B ;

R A and R B , together with the oxygen atoms to which they are bound, combine to form:

R 3 , R 4 , R 6 , and R 7 are each H;

R 5 is OR C ;

R 8 is OH or NH 2 ; and

R 9 is H or OH;

(b) Rand R 2 are each independently H or OH;

R 3 is R C ;

R 4 , R 6 , and R 7 are each H;

R 5 is H, OH, or OC 1 -C 6 alkyl;

R 8 is OH or NH 2 ; and

R 9 is H or OH;

(c) R 1 and R 2 are each independently H or OH;

R 3 , R 6 , and R 7 are each H;

R 4 and R 5 are each independently H, OH, OR C , or R C ;

R 8 is OH or NH 2 ; and

R 9 is H or OH;

or

(d) R 1 and R 2 are each independently H or OH;

R 3 , R 6 , and R 7 are each H;

R 4 and R 5 are each independently H or OH;

R 8 is OR C or NHR C ; and

R 9 is H or OH.

7. The method of claim 1 , wherein the antibody or antigen-binding fragment thereof conjugated to a cytotoxin is represented by the formula Ab-L-Z-Am, wherein Ab is the antibody or antigen-binding fragment thereof, Z is a chemical moiety, L is a linker, and Am is an amatoxin, and the amatoxin-linker conjugate Am-L-Z is represented by formula (IIB)

wherein X is S, SO, or SO 2 ;

R 1 is H or a linker covalently bound to the antibody or antigen-binding fragment thereof through a chemical moiety Z, formed from a coupling reaction between a reactive substituent present on the linker and a reactive substituent present within an antibody, or antigen-binding fragment thereof; and

R 2 is H or a linker covalently bound to the antibody or antigen-binding fragment thereof through a chemical moiety Z, formed from a coupling reaction between a reactive substituent present on the linker and a reactive substituent present within an antibody, or antigen-binding fragment thereof;

wherein when R 1 is H, R 2 is the linker, and when R 2 is H, R 1 is the linker.

8. The method of claim 2 , wherein the hematopoietic stem cells or progeny thereof are capable of localizing to hematopoietic tissue and/or reestablishing hematopoiesis following transplantation of the hematopoietic stem cells into the patient.

9. The method of claim 7 , wherein the linker includes a —(CH 2 ) n — unit, wherein n is an integer from 2-6, or wherein the linker includes a dipeptide selected from Val-Ala and Val-Cit.

10. The method of claim 7 , wherein Am-L-Z-Ab is one of:

11. The method of claim 3 , wherein the antibody or antigen-binding fragment thereof,

comprises a V L having the amino acid sequence DIQMTQSPSSMSASLGDRVTITCRASQDINSYLSWFQQKPGKSPKTLIYRANRL VDGVPSRFSGSGSGTDYTLTISSLQYEDFGIYYCQQYDESPWTFGGGTKLEIK (SEQ ID NO: 1); and a V H having the amino acid sequence QIQLVQSGPGLKKPGGSVRISCAASGYTFTNYGMNWVKQAPGKGLRWMGWI NTHTGEPTYADDFKGRFTFSLDTSKSTAYLQINSLRAEDTATYFCTRRGYDWY FDVWGQGTTVTVSS (SEQ ID NO: 2); or

comprises a V L having the amino acid sequence NIVMTQSPSSLSASVGDRVTITCQASQDVGTAVAWYQQKPDQSPKLLIYWTSTRHTGVP DRFTGSGS GTDFTLTISSLQPEDIATYFCHQYNSYNTFGSGTKLEIK (SEQ ID NO: 258); and a V H having the amino acid sequence QVTLKESGPVLVKPTETLTLTCTFSGFSLSTSGMGVGWIRQAPGKGLEWVAHIWWDDD VYYNPSLKSRLTITKDASKDQVSLKLSSVTAADTAVYYCVRRRATGTGFDYWGQGTLV TVSS (SEQ ID NO: 257).

12. The method of claim 2 , wherein R A and R B , together with the oxygen atoms to which they are bound, combine to form a 5 membered heterocycloalkyl group of formula:

wherein Y is —C(—O)—, —C(═S)—, —C(═NR E )—, or —C(R E R E′ )—; and

R E and R E′ are each independently C 1 -C 6 alkylene-R C , C 1 -C 6 heteroalkylene-R C , C 2 -C 6 alkenylene-R C , C 2 -C 6 heteroalkenylene-R C , C 2 -C 6 alkynylene-R C , C 2 -C 6 heteroalkynylene-R C , cycloalkylene-R C , heterocycloalkylene-R C , arylene-R C , or heteroarylene-R C .

13. The method of claim 2 , wherein the antibody or antigen-binding fragment thereof conjugated to a cytotoxin is represented by the formula Ab-L-Z-Am, wherein Ab is the antibody or antigen-binding fragment thereof, Z is a chemical moiety, L is a linker, and Am is an amatoxin, and the amatoxin-linker conjugate Am-L-Z is represented by formula (IIB)

wherein X is S, SO, or SO 2 ;

R 1 is H or a linker covalently bound to the antibody or antigen-binding fragment thereof through a chemical moiety Z, formed from a coupling reaction between a reactive substituent present on the linker and a reactive substituent present within an antibody, or antigen-binding fragment thereof; and

R 2 is H or a linker covalently bound to the antibody or antigen-binding fragment thereof through a chemical moiety Z, formed from a coupling reaction between a reactive substituent present on the linker and a reactive substituent present within an antibody, or antigen-binding fragment thereof;

wherein when R 1 is H, R 2 is the linker, and when R 2 is H, R 1 is the linker.

Assignments (4)
CORRECTIVE ASSIGNMENT TO CORRECT THE CORRECT THE ASSIGNEE'S POSTAL CODE FROM "68256" TO "68526" PREVIOUSLY RECORDED AT REEL: 69183 FRAME: 32. ASSIGNOR(S) HEREBY CONFIRMS THE ASSIGNMENT. Recorded Nov 13, 2024
From: MAGENTA THERAPEUTICS, INC.
To: HEIDELBERG PHARMA RESEARCH GMBH
Reel/Frame 069351/0945 →
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Nov 7, 2024
From: BOITANO, ANTHONY; COOKE, MICHAEL; PALCHAUDHURI, RAHUL; MCDONOUGH, SEAN
To: MAGENTA THERAPEUTICS, INC.
Reel/Frame 069182/0708 →
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Nov 7, 2024
From: MAGENTA THERAPEUTICS, INC.
To: HEIDELBERG PHARMA RESEARCH GMBH
Reel/Frame 069183/0032 →
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Jul 7, 2023
From: MAGENTA THERAPEUTICS, INC.
To: HEIDELBERG PHARMA RESEARCH GMBH
Reel/Frame 064178/0212 →
Continuity (4)
Continuation 16851082 · Apr 16, 2020
Continuation PCTUS2018063175 · Nov 29, 2018
Provisional Application 62592214 · Nov 29, 2017
Related Publication 20210369854A1 · Dec 2, 2021
References Cited (310)
US 3896111A · Kupchan et al. · 1975 [cited by applicant]
US 4137230A · Hashimoto et al. · 1979 [cited by applicant]
US 4151042A · Higashide et al. · 1979 [cited by applicant]
US 4248870A · Miyashita et al. · 1981 [cited by applicant]
US 4256746A · Miyashita et al. · 1981 [cited by applicant]
US 4260608A · Miyashita et al. · 1981 [cited by applicant]
US 4265814A · Hashimoto et al. · 1981 [cited by applicant]
US 4294757A · Asai · 1981 [cited by applicant]
US 4307016A · Asai et al. · 1981 [cited by applicant]
US 4308268A · Miyashita et al. · 1981 [cited by applicant]
US 4308269A · Miyashita et al. · 1981 [cited by applicant]
US 4309428A · Miyashita et al. · 1982 [cited by applicant]
US 4313946A · Powell et al. · 1982 [cited by applicant]
US 4315929A · Freedman et al. · 1982 [cited by applicant]
US 4317821A · Miyashita et al. · 1982 [cited by applicant]
US 4322348A · Asai et al. · 1982 [cited by applicant]
US 4331598A · Hasegawa et al. · 1982 [cited by applicant]
US 4361650A · Asai et al. · 1982 [cited by applicant]
US 4362663A · Kida et al. · 1982 [cited by applicant]
US 4363799A · Kung et al. · 1982 [cited by applicant]
US 4364866A · Asai et al. · 1982 [cited by applicant]
US 4371533A · Akimoto et al. · 1983 [cited by applicant]
US 4424219A · Hashimoto et al. · 1984 [cited by applicant]
US 4450254A · Isley et al. · 1984 [cited by applicant]
US 4515894A · Kung et al. · 1985 [cited by applicant]
US 4657760A · Kung et al. · 1987 [cited by applicant]
US 4675386A · Royston et al. · 1987 [cited by applicant]
US 4880935A · Thorpe · 1989 [cited by applicant]
US 5122368A · Greenfield et al. · 1992 [cited by applicant]
US 5208020A · Chari et al. · 1993 [cited by applicant]
US 5413923A · Kucherlapati et al. · 1995 [cited by applicant]
US 5416064A · Chari et al. · 1995 [cited by applicant]
US 5475092A · Chari et al. · 1995 [cited by applicant]
US 5530101A · Queen et al. · 1996 [cited by applicant]
US 5545806A · Lonberg et al. · 1996 [cited by applicant]
US 5569825A · Lonberg et al. · 1996 [cited by applicant]
US 5585089A · Queen et al. · 1996 [cited by applicant]
US 5585499A · Chari et al. · 1996 [cited by applicant]
US 5621002A · Bosslet et al. · 1997 [cited by applicant]
US 5621083A · Better et al. · 1997 [cited by applicant]
US 5622929A · Willner et al. · 1997 [cited by applicant]
US 5625126A · Lonberg et al. · 1997 [cited by applicant]
US 5633425A · Lonberg et al. · 1997 [cited by applicant]
US 5635483A · Pettit et al. · 1997 [cited by applicant]
US 5648237A · Carter · 1997 [cited by applicant]
US 5661016A · Lonberg et al. · 1997 [cited by applicant]
US 5663149A · Pettit et al. · 1997 [cited by applicant]
US 5693761A · Queen et al. · 1997 [cited by applicant]
US 5693762A · Queen et al. · 1997 [cited by applicant]
US 5712374A · Kuntsmann et al. · 1998 [cited by applicant]
US 5714586A · Kuntsmann et al. · 1998 [cited by applicant]
US 5730979A · Bazin et al. · 1998 [cited by applicant]
US 5739116A · Hamann et al. · 1998 [cited by applicant]
US 5744580A · Better et al. · 1998 [cited by applicant]
US 5756699A · Better et al. · 1998 [cited by applicant]
US 5766886A · Studnicka et al. · 1998 [cited by applicant]
US 5767285A · Hamann et al. · 1998 [cited by applicant]
US 5770196A · Studnicka · 1998 [cited by examiner]
US 5770701A · McGahren et al. · 1998 [cited by applicant]
US 5770710A · McGahren et al. · 1998 [cited by applicant]
US 5773001A · Hamann et al. · 1998 [cited by applicant]
US 5780588A · Pettit et al. · 1998 [cited by applicant]
US 5789199A · Joly et al. · 1998 [cited by applicant]
US 5795572A · Diegel et al. · 1998 [cited by applicant]
US 5807734A · Diegel et al. · 1998 [cited by applicant]
US 5814318A · Lonberg et al. · 1998 [cited by applicant]
US 5817311A · Bazin et al. · 1998 [cited by applicant]
US 5821123A · Studnicka · 1998 [cited by applicant]
US 5824805A · King et al. · 1998 [cited by applicant]
US 5837491A · Better et al. · 1998 [cited by applicant]
US 5840523A · Simmons et al. · 1998 [cited by applicant]
US 5846545A · Chari et al. · 1998 [cited by applicant]
US 5869619A · Studnicka · 1999 [cited by examiner]
US 5877296A · Hamann et al. · 1999 [cited by applicant]
US 5885793A · Griffiths et al. · 1999 [cited by applicant]
US 5916771A · Hori et al. · 1999 [cited by applicant]
US 5939598A · Kucherlapati et al. · 1999 [cited by applicant]
US 5951983A · Bazin et al. · 1999 [cited by applicant]
US 6010902A · Ledbetter et al. · 2000 [cited by applicant]
US 6054297A · Carter et al. · 2000 [cited by applicant]
US 6146631A · Better et al. · 2000 [cited by applicant]
US 6146850A · Better et al. · 2000 [cited by applicant]
US 6162432A · Wallner et al. · 2000 [cited by applicant]
US 6180370B1 · Queen et al. · 2001 [cited by applicant]
US 6214345B1 · Firestone et al. · 2001 [cited by applicant]
US 6218519B1 · Kenten et al. · 2001 [cited by applicant]
US 6268488B1 · Barbas, III et al. · 2001 [cited by applicant]
US 6333410B1 · Chari et al. · 2001 [cited by applicant]
US 6376217B1 · Better et al. · 2002 [cited by applicant]
US 6441163B1 · Chari et al. · 2002 [cited by applicant]
US 6541611B1 · Bazin et al. · 2003 [cited by applicant]
US 6558662B2 · Sykes et al. · 2003 [cited by applicant]
US 6649742B1 · Better et al. · 2003 [cited by applicant]
US 6677435B2 · Barbas, III et al. · 2004 [cited by applicant]
US 6716821B2 · Zhao et al. · 2004 [cited by applicant]
US 6759509B1 · King et al. · 2004 [cited by applicant]
US 6764688B2 · Yamashita et al. · 2004 [cited by applicant]
US 6835807B1 · Susaki et al. · 2004 [cited by applicant]
US 6849258B1 · Bazin et al. · 2005 [cited by applicant]
US 7115259B2 · Horwitz · 2006 [cited by applicant]
US 7153932B2 · Better et al. · 2006 [cited by applicant]
US 7192736B2 · McDonald et al. · 2007 [cited by applicant]
US 7223837B2 · De Groot et al. · 2007 [cited by applicant]
US 7250167B2 · Bazin et al. · 2007 [cited by applicant]
US 7276497B2 · Chari et al. · 2007 [cited by applicant]
US 7332157B2 · Sykes · 2008 [cited by applicant]
US 7368565B2 · Chari et al. · 2008 [cited by applicant]
US 7408039B2 · Sykes et al. · 2008 [cited by applicant]
US 7473796B2 · Chari et al. · 2009 [cited by applicant]
US 7521541B2 · Eigenbrot et al. · 2009 [cited by applicant]
US 7592006B1 · Bazin et al. · 2009 [cited by applicant]
US 7638121B2 · Sykes · 2009 [cited by applicant]
US 7754681B2 · Feng · 2010 [cited by applicant]
US 7939062B2 · Sykes · 2011 [cited by applicant]
US 8236319B2 · Chari et al. · 2012 [cited by applicant]
US 8679500B2 · Boumsell et al. · 2014 [cited by applicant]
US 9233173B2 · Faulstich et al. · 2016 [cited by applicant]
US 9399681B2 · Anderl et al. · 2016 [cited by applicant]
US 9504756B2 · Lyon et al. · 2016 [cited by applicant]
US 9636421B2 · Verkade et al. · 2017 [cited by applicant]
US 9676702B2 · Lutz et al. · 2017 [cited by applicant]
US 10072091B2 · Weissman et al. · 2018 [cited by applicant]
US 10842882B2 · Anderl et al. · 2020 [cited by applicant]
US 20020051784A1 · Boussiotis et al. · 2002 [cited by applicant]
US 20030096743A1 · Senter et al. · 2003 [cited by applicant]
US 20030130189A1 · Senter et al. · 2003 [cited by applicant]
US 20040018194A1 · Francisco et al. · 2004 [cited by applicant]
US 20040052793A1 · Carter et al. · 2004 [cited by applicant]
US 20040121940A1 · De Groot et al. · 2004 [cited by applicant]
US 20040265315A1 · Dingivan et al. · 2004 [cited by applicant]
US 20050169933A1 · Steeves et al. · 2005 [cited by applicant]
US 20050238649A1 · Doronina et al. · 2005 [cited by applicant]
US 20050256030A1 · Feng · 2005 [cited by applicant]
US 20060051355A1 · van Oosterhout et al. · 2006 [cited by applicant]
US 20060084107A1 · Wallner et al. · 2006 [cited by applicant]
US 20080245027A1 · Lambertini · 2008 [cited by applicant]
US 20080254027A1 · Bernett · 2008 [cited by examiner]
US 20110091453A1 · Dingivan · 2011 [cited by applicant]
US 20110250203A1 · Klitgaard et al. · 2011 [cited by applicant]
US 20110280868A1 · Dingivan et al. · 2011 [cited by applicant]
US 20120045435A1 · Deisher · 2012 [cited by examiner]
US 20120121598A1 · Boumsell et al. · 2012 [cited by applicant]
US 20120213805A1 · Faulstich et al. · 2012 [cited by applicant]
US 20130183322A1 · Reisner et al. · 2013 [cited by applicant]
US 20140294865A1 · Simon et al. · 2014 [cited by applicant]
US 20140369974A1 · Reisner et al. · 2014 [cited by applicant]
US 20150004145A1 · Lemischka et al. · 2015 [cited by applicant]
US 20150079114A1 · Ohtsuka et al. · 2015 [cited by applicant]
US 20150218220A1 · Mendelsohn et al. · 2015 [cited by applicant]
US 20160002298A1 · Müller et al. · 2016 [cited by applicant]
US 20160089450A1 · Faulstich et al. · 2016 [cited by applicant]
US 20160120947A1 · Scadden et al. · 2016 [cited by applicant]
US 20160303254A1 · Kolakowski et al. · 2016 [cited by applicant]
US 20160324982A1 · Scadden et al. · 2016 [cited by applicant]
US 20170080102A1 · Whiteman et al. · 2017 [cited by applicant]
US 20170129128A1 · Mortaro et al. · 2017 [cited by applicant]
US 20170298145A1 · Verkade et al. · 2017 [cited by applicant]
US 20170360954A1 · Nixon · 2017 [cited by examiner]
US 20180289832A1 · Hartigan et al. · 2018 [cited by applicant]
US 20180346876A1 · Xiao et al. · 2018 [cited by applicant]
US 20190100593A1 · Scadden et al. · 2019 [cited by applicant]
US 20190134217A1 · Nixon et al. · 2019 [cited by applicant]
US 20190314411A1 · Xiao et al. · 2019 [cited by applicant]
EP 0425235 · 1996 [cited by applicant]
EP 0349578 · 1998 [cited by applicant]
EP 0527839 · 1998 [cited by applicant]
EP 0589877 · 2005 [cited by applicant]
EP 1661584 · 2006 [cited by applicant]
EP 1859811 · 2007 [cited by applicant]
EP 2416805 · 2010 [cited by applicant]
WO 8906968 · 1989 [cited by applicant]
WO 9201047 · 1992 [cited by applicant]
WO 9214491 · 1992 [cited by applicant]
WO 9216563 · 1992 [cited by applicant]
WO 9420619 · 1994 [cited by applicant]
WO 9423747 · 1994 [cited by applicant]
WO 9633735 · 1996 [cited by applicant]
WO 9634096 · 1996 [cited by applicant]
WO 9641608 · 1996 [cited by applicant]
WO 9813059 · 1998 [cited by applicant]
WO 9824893 · 1998 [cited by applicant]
WO 9903502 · 1999 [cited by applicant]
WO 02088172 · 2002 [cited by applicant]
WO 2004032828 · 2004 [cited by applicant]
WO 2005026210 · 2005 [cited by applicant]
WO 2005037992 · 2005 [cited by applicant]
WO 2005081711 · 2005 [cited by applicant]
WO 2006034488 · 2006 [cited by applicant]
WO WO2008121160A2 · 2008 [cited by examiner]
WO 2010022737 · 2010 [cited by applicant]
WO 2010115630 · 2010 [cited by applicant]
WO WO2010115629A2 · 2010 [cited by examiner]
WO 2010145895 · 2010 [cited by applicant]
WO 2014083505 · 2014 [cited by applicant]
WO 2014151030 · 2014 [cited by applicant]
WO WO2016071856A1 · 2016 [cited by examiner]
WO WO2016142049A1 · 2016 [cited by examiner]
WO 2016164502 · 2016 [cited by applicant]
WO 2016172606 · 2016 [cited by applicant]
WO 2017004026 · 2017 [cited by applicant]
WO 2017046658 · 2017 [cited by applicant]
WO 2017089607 · 2017 [cited by applicant]
WO 2017149077 · 2017 [cited by applicant]
WO 2017191579 · 2017 [cited by applicant]
WO 2017219025 · 2017 [cited by applicant]
WO 2018115466 · 2018 [cited by applicant]
WO 2018134787 · 2018 [cited by applicant]
WO 2019030171 · 2019 [cited by applicant]
WO 2019084064 · 2019 [cited by applicant]
WO 2019108863 · 2019 [cited by applicant]
WO 2020023561 · 2020 [cited by applicant]
Lloyd et al., Protein Engineering, Design & Selection 22:159-168 (Year: 2009). [cited by examiner]
Edwards et al., J Mol Biol. 334(1): 103-118 (Year: 2003). [cited by examiner]
Strop et al., Chemistry and Biology 20: 161-167 (Year: 2013). [cited by examiner]
Antin et al., “Selective Depletion of Bone Marrow T Lymphocytes with Anti-CD5 Monoclonal Antibodies: Effective Prophylaxis for Graft-Versus-Host Disease in Patients with Hematologic Malignancies”, Blood, vol. 78, No. 8,… [cited by applicant]
Barbas III et al., “Assembly of combinatorial antibody libraries on phage surfaces: The gene III site”, Proc. Natl. Acad. Sci. USA, vol. 88, Sep. 1991, pp. 7978-7982. [cited by applicant]
Bird et al., “Single-Chain Antigen-Binding Proteins”, Science, vol. 242, Oct. 21, 1988, pp. 423-426. [cited by applicant]
Bose et al., “Rational Design of a Highly Efficient Irreversible DNA Interstrand Cross-Linking Agent Based on the Pyrrolobenzodiazepine Ring System”, J. Am. Chem. Soc., vol. 114, No. 12, 1992, pp. 4939-4941. [cited by applicant]
Branco et al., “Selective Deletion of Antigen-Specific, Activated T Cells by a Humanized MAB to CD2 (MEDI-507) is Mediated by NK Cells”, Transplantation, vol. 68, No. 10, Nov. 27, 1999, pp. 1588-1596. [cited by applicant]
Bradley A. Katz, “Structural and Mechanistic Determinants of Affinity and Specificity of Ligands Discovered or Engineered by Phage Display”, Annu. Rev. Biophys. Biomol. Struct., vol. 26, 1997, pp. 27-45. [cited by applicant]
Brian K. Kay, “Biologically displayed random peptides as reagents in mapping protein-protein interactions”, Perspectives in Drug Discovery and Design, vol. 2, Mar. 9, 1995, pp. 251-268. [cited by applicant]
Byers et al., “Use of an Anti-Pan T-Lymphocyte Ricin A Chain Immunotoxin in Steroid-Resistant Acute Graft-Versus-Host Disease”, Blood, vol. 75, No. 7, Apr. 1, 1990, pp. 1426-1432. [cited by applicant]
Carl et al., “A Novel Connector Linkage Applicable in Prodrug Design”, Journal of Medicinal Chemistry, vol. 24, No. 5, May 1981, pp. 479-480. [cited by applicant]
Chakravarty et al., “Plasmin-Activated Prodrugs for Cancer Chemotherapy. 2. Synthesis and Biological Activity of Peptidyl Derivatives of Doxorubicin”, J. Med. Chem., vol. 26, No. 5, 1983, pp. 638-644. [cited by applicant]
Chari et al., “Immunoconjugates Containing Novel Maytansinoids: Promising Anticancer Drugs”, Cancer Research, vol. 52, Jan. 1, 1992, pp. 127-131. [cited by applicant]
Chiswell et al., “Phage antibodies: will new ‘coliclonal’ antibodies replace monoclonal antibodies?”, Trends Biotechnol., vol. 10, Mar. 1992, pp. 80-84. [cited by applicant]
Clackson et al., “Making antibody fragments using phage display libraries”, Nature, vol. 352, Aug. 15, 1991, pp. 624-628. [cited by applicant]
Cox et al., “A directory of human germ-line Vx segments reveals a strong bias in their usage”, Eur. J. Immunol., vol. 24, 1994, pp. 827-836. [cited by applicant]
Dall'Acqua et al., “Properties of Human IgG1s Engineered for Enhanced Binding to the Neonatal Fc Receptor (FcRn)”, The Journal of Biological Chemistry, vol. 281, No. 33, Aug. 18, 2006, pp. 23514-23524. [cited by applicant]
Datta-Mannan et al., “Humanized IgG [cited by applicant]
De Groot et al., “Elongated Multiple Electronic Cascade and Cyclization Spacer Systems in Activatible Anticancer Prodrugs for Enhanced Drug Release”, J. Org. Chem., vol. 66, No. 26, Jul. 3, 2001, pp. 8815-8830. [cited by applicant]
Doronina et al., “Development of potent monoclonal antibody auristatin conjugates for cancer therapy”, Nature Biotechnology, vol. 21, No. 7, Jul. 2003, pp. 778-784. [cited by applicant]
Doronina et al., “Enhanced Activity of Monomethylauristatin F through Monoclonal Antibody Delivery: Effects of Linker Technology on Efficacy and Toxicity”, Bioconjugate Chem., vol. 17, No. 1, 2006, pp. 114-124. [cited by applicant]
Dubowchik et al., “Receptor-mediated and enzyme-dependent targeting of cytotoxic anticancer drugs”, Pharmacology & Therapeutics, vol. 83, 1999, pp. 67-123. [cited by applicant]
Extended European Search Report dated Oct. 12, 2021, in EP 18883067.3, 9 pages. [cited by applicant]
Extended European Search Report dated Jan. 26, 2024, in EP 20818567.8, 16 pages. [cited by applicant]
Felici et al., “Peptide and protein display on the surface of filamentous Bacteriophage”, Biotechnology Annual Review, vol. 1, 1995, pp. 149-183. [cited by applicant]
Graham et al., “Characteristics of a Human Cell Line Transformed by DNA from Human Adenovirus Type 5”, J. Gen Virol., vol. 36, Feb. 10, 1977, pp. 59-72. [cited by applicant]
Gregson et al., “Design, Synthesis, and Evaluation of a Novel Pyrrolobenzodiazepine DNA-Interactive Agent with Highly Efficient Cross-Linking Ability and Potent Cytotoxicity”, J. Med. Chem., vol. 44, No. 5, 2001, pp. 73… [cited by applicant]
Greg T. Hermanson, “Bioconjugate Techniques” Second Edition, Academic Press: New York, Homobifunctional Crosslinkers, 2013, pp. 234-242. [cited by applicant]
Gu et al., “Generation of Dual-Variable-Domain Immunoglobulin Molecules for Dual-Specific Targeting”, Methods in Enzymology, vol. 502, 2012, pp. 25-41. [cited by applicant]
Hay et al., “A 2-Nitroimidazole Carbamate Prodrug of 5-Amino-1-(Chloromethyl)-3-[(5,6,7-Trimethoxyindol-2-YL)Carbonyl]-1,2-Dihydro-3H-Benze[E]Indole (AMINO-SECO-CBI-TMI) For Use With Debt and GDEPT”, Bioorg. Med. Chem. … [cited by applicant]
Henslee et al., “A New Approach to the Prevention of Graft-Versus-Host Disease Using XomaZyme-H65 Following Histo-incompatible Partially T-depleted Marrow Grafts”, Transplantation Proceedings, vol. 21, No. 1, Feb. 1989,… [cited by applicant]
Henslee-Downey et al., “Combined in vitro T Lymphocyte Depletion for the control of Graft-Versus-Host disease Following Haploidentical Marrow Transplant”, Transplantation, vol. 61, No. 5, Mar. 15, 1996, pp. 1-17. [cited by applicant]
Hinman et al., “Preparation and Characterization of Monoclonal Antibody Conjugates of the Calicheamicins: A Novel and Potent Family of Antitumor Antibiotics”, Cancer Research, vol. 53, Jul. 15, 1993, pp. 3336-3342. [cited by applicant]
Hinton et al., “Engineered Human IgG Antibodies with Longer Serum Half-Lives in Primates”, The Journal of Biological Chemistry, vol. 279, No. 8, Feb. 20, 2004, pp. 6213-6216. [cited by applicant]
Hinton et al., “An Engineered Human IgG1 Antibody with Longer Seru Half-Life”, J. Immunol., vol. 176, No. 1, Jan. 1, 2006, pp. 346-356. [cited by applicant]
Hirahara et al., “CD4 [cited by applicant]
Holliger et al., ““Diabodies”: Small bivalent and bispecific antibody fragments”, Proc. Natl. Acad. Sci. USA, vol. 90, Jul. 1993, pp. 6444-6448. [cited by applicant]
Hoogenboom et al., “Antibody phage display technology and its applications”, Immunotechnology, vol. 4, Feb. 13, 1998, pp. 1-20. [cited by applicant]
Huston et al., “Protein engineering of antibody binding sites: Recovery of specific Activity in an anti-digoxin single-chain Fv analogue produced in [cited by applicant]
International Search Report received for PCT/US2018/063175, dated Apr. 26, 2019, 6 pages. [cited by applicant]
International Search Report received for PCT/US2020/036494, dated Sep. 21, 2020, 4 pages. [cited by applicant]
Jain et al., “Current ADC Linker Chemistry”, Pharm. Res., vol. 32, Mar. 11, 2015, pp. 3526-3540. [cited by applicant]
Jennie P. Mather, “Establishment and Characterization of Two Distinct Mouse Testicular Epithelial Cell Lines”, Biology of Reproduction, vol. 23, Apr. 29, 1980, pp. 243-252. [cited by applicant]
Jones et al., “Isolation of complementary DNA clones encoding the human lymphocyte glycoprotein T1/Leu-1”, Nature, vol. 323, Sep. 25, 1986, pp. 346-349. [cited by applicant]
Kay et al., “High-throughput screening strategies to identify inhibitors of protein-protein interactions”, Molecular Diversity, vol. 1, 1995, pp. 139-140. [cited by applicant]
Keith A. Charlton, “Expression and Isolation of Recombinant Antibody Fragments in [cited by applicant]
Kim et al., “Mapping the site on human IgG for binding of the MHC class I-related receptor, FcRn”, Eur. J. Immunol., vol. 29, Sep. 6, 1999, pp. 2819-2825. [cited by applicant]
Kostelny et al., “Formation of A Bispecific Antibody by the use of Leucin Zippers”, The Journal of Immunology, vol. 148, No. 5, Mar. 1, 1992, pp. 1547-1553. [cited by applicant]
Laguzza et al., “New Antitumor Monoclonal Antibody-Vinca Conjugates LY203725 and Related Compounds: Design, Preparation, and Representative in Vivo Activity”, J. Med. Chem., vol. 32, No. 3, 1989, pp. 548-555. [cited by applicant]
Leriche et al., “Cleavable linkers in chemical biology”, Bioorganic & Medicinal Chemistry, vol. 20, 2012, pp. 571-582. [cited by applicant]
Liu et al., “New Produces for Preparation and Isolation of Conjugates of Proteins and a Synthetic Copolymer of D-Amino Acids and Immunochemical characterization of Such Conjugates”, Biochemistry, vol. 18, No. 4, 1979, p… [cited by applicant]
Lode et al., “Targeted Therapy with a Novel Enediyene Antibiotic Calicheamicin θ [cited by applicant]
Manske et al., “Antigenic Modulation by Anti-Cd5 Immunotoxins”, The Journal of Immunology, vol. 136, No. 12, Jun. 15, 1986, pp. 4721-4728. [cited by applicant]
Maher et al., “Culture of Testicular Cells in Hormone-Supplemented Serum-Free Medium”, Annals N.Y. Acad. Sci., vol. 383, 1982, pp. 44-68. [cited by applicant]
McCafferty et al., “Phage antibodies: filamentous phage displaying antibody variable domains”, Nature, vol. 348, Dec. 6, 1990, pp. 552-554. [cited by applicant]
Miller et al., “A New Class of Antibody-Drug Conjugates with Potent DNA Alkylating Activity”, Mol. Cancer Ther., vol. 15, No. 8, Aug. 2016, pp. 1870-1878. [cited by applicant]
Miller et al., “Monoclonal Antibody Therapeutic Trials in Seven Patients With T-Cell Lymphoma”, Blood, vol. 62, No. 5, Nov. 1983, pp. 988-995. [cited by applicant]
Neville, Jr. et al., “Enhancement of Immunotoxin Efficacy by Acid-cleavable Cross-linking Agents Utilizing Diphtheria Toxin and Toxin Mutants”, The Journal of Biological Chemistry, vol. 264, No. 25, Mar. 30, 1989, pp. 1… [cited by applicant]
N. R. Bachur, “Free Radical Damage”, Anthracycline Antibiotics in Cancer Therapy, 1982, pp. 97-102. [cited by applicant]
Paul Polakis, “Antibody Drug Conjugates for Cancer Therapy”, Pharmacol. Rev., vol. 68, Jan. 2016, pp. 3-19. [cited by applicant]
Peterson et al., “Transport and Storage of Anthracycline in Experimental Systems and Human Leukemia” in [cited by applicant]
Petkova et al., “Enhanced half-life of genetically engineered human IgG1 antibodies in a humanized FcRn mouse model: potential application in humorally mediated autoimmune disease”, International Immunology, vol. 18, No… [cited by applicant]
Pettit et al., “The Absolute Configuration and Synthesis of Natural (−)-Dolastatin 101”, J. Am. Chem. Soc., vol. 111, No. 14, 1989, pp. 5463-5465. [cited by applicant]
Pettit et al., “Dolastatins 24. Synthesis of (−)-dolastatin 10.1 X-Ray molecular structure of N,N-dimethylvalyl-valyl-dolaisoleuine tert-butyl ester”, J. Chem. Soc. Perkin Trans., vol. 1, 1996, pp. 859-863. [cited by applicant]
Pettit et al., “Antineoplastic agents 365. Dolastatin 10 SAR probes”, Anti-Cancer Drug Design, vol. 13, Sep. 3, 1997, pp. 243-277. [cited by applicant]
Pettit et al., “Specific Activities of Dolastatin 10 and Peptide Derivatives against [cited by applicant]
Pettit et al., “The Dolastatins; 18: Stereospecific Synthesis of Dolaproine”, Synthesis, Jun. 1996, pp. 719-725. [cited by applicant]
Przepiorka et al., “Evaluation of anti-CD5 ricin A chain immunoconjugate for prevention of acute graft-vs.-host disease after HLA-identical marrow transplantation”, Therapeutic Immunology, vol. 1, 1994, pp. 77-82. [cited by applicant]
Quintieri et al., “Formation and Antitumor Activity of PNU-159682, A Major Metabolite of Nemorubicin in Human Liver Microsomes”, Clinical Cancer Research, vol. 11, Feb. 15, 2005, pp. 1608-1617. [cited by applicant]
Raphael et al., “T cell subsets and their signature cytokines in autoimmune and inflammatory diseases”, Cytokine, vol. 74, No. 1, Jul. 2015, pp. 5-17. [cited by applicant]
Riechmann et al., “Reshaping human antibodies for therapy”, Nature, vol. 332, Mar. 24, 1988, pp. 323-327. [cited by applicant]
Royston et al., “Human T Cell Antigens defined by Monoclonal Antibodies: the 65,000-Dalton Antigen of T Cells (T65) is also found on Chronic Lymphocytic Leukemia Cells bearing surface immunoglobulin1”, The Journal of Im… [cited by applicant]
Seed et al., “Molecular cloning of the CD2 antigen, the T-cell erythrocyte receptor, by a rapid immunoselection procedure”, Proc. Natl. Acad. Sci. USA, vol. 84, May 1987, pp. 3365-3369. [cited by applicant]
Sessa et al., “Ongoing phase I and II studies of novel anthracyclines”, Cardiovasc. Toxicol., vol. 7, May 22, 2007, pp. 75-79. [cited by applicant]
Sewell et al., “Molecular cloning of the human T-lymphocyte surface CD2 (T11) antigen”, Proc. Natl. Acad. Sci. USA, vol. 83, Nov. 1986, pp. 8718-8722. [cited by applicant]
Shawler et al., “Induction of in Vitro and in Vivo Antigenic Modulation by the Anti-Human T-Cell Monoclonal Antibody T101”, Cancer Research, vol. 44, Dec. 1984, pp. 5921-5927. [cited by applicant]
Shields et al., “High Resolution Mapping of the Binding Site on Human IgG1 for FcyRI, FcyRII, FcyRIII, and FcRn and Design of IgG1 Variants with Improved Binding to the FcyR”, The Journal of Biological Chemistry, vol. 2… [cited by applicant]
Sondermann et al., “The 3.2-Å crystal structure of the human lgG1 Fc fragment-FcyRIII complex”, Nature, vol. 406, Jul. 20, 2000, pp. 267-273. [cited by applicant]
Songsivilai et al., “Bispecific antibody: a tool for diagnosis and treatment of disease”, Clin. Exp. Immunol., vol. 79, 1990, pp. 315-321. [cited by applicant]
Sullivan et al., “Bone Marrow Transplantation for Non-Malignant Disease”, American Society of Hematology, 2000, pp. 319-338. [cited by applicant]
Sun et al., “Overview of Orchestration of CD4+ T Cell Subsets in Immune Responses”, Adv. Exp. Med. Biol., vol. 841, 2014, pp. 1-13. [cited by applicant]
Sussman et al., “Engineered cysteine antibodies: an improved antibody-drug conjugate platform with a novel mechanism of drug-linker stability”, Protein Engineering, Design & Selection, vol. 31, No. 2, Jan. 23, 2018, pp.… [cited by applicant]
Sutherland et al., “SGN-CD33A: a novel CD33-targeting antibody-drug conjugate using a pyrrolobenzodiazepine dimer is active in models of drug-resistant AML”, Blood, vol. 122, No. 8, Aug. 22, 2013, pp. 1455-1463. [cited by applicant]
Thorpe et al., “New Coupling Agents for the Synthesis of Immunotoxins Containing a Hindered Disulfide Bond with Improved Stability in Vivo”, Cancer Research, vol. 47, Nov. 15, 1987, pp. 5924-5931. [cited by applicant]
Urlaub et al., “Isolation of Chinese hamster cell mutants deficient in dihydrofolate Reductase activity”, Proc. Natl. Acad. Sci. USA, vol. 77, No. 7, Jul. 1980, pp. 4216-4220. [cited by applicant]
Vaccaro et al., “Engineering the Fc region of immunoglobulin G to modulate in vivo antibody levels”, Nature Biotechnology, vol. 23, No. 10, Oct. 2005, pp. 1283-1288. [cited by applicant]
Ward et al., “Binding activities of a repertoire of single immunoglobulin variable domains secreted from [cited by applicant]
Werner-Favre et al., “Cell surface antigen CD5 is a marker for activated human B cells”, Eur. J. Immunol., vol. 19, 1989, pp. 1209-1213. [cited by applicant]
Williams et al., “Cell-based selection of internalizing fully human antagonistic antibodies directed against FLT3 for suppression of leukemia cell growth”, Leukemia, vol. 19, Jun. 2, 2005, pp. 1432-1438. [cited by applicant]
Woyke et al., “In Vitro Activities and Postantifungal Effects of the Potent Dolastatin 10 Derivative Auristatin PHE”, Antimicrobial Agents and Chemotherapy, vol. 45, No. 12, Dec. 2001, pp. 3580-3584. [cited by applicant]
Written Opinion dated Apr. 26, 2019, in PCT/US2018/063175, 12 pages. [cited by applicant]
Written Opinion dated Sep. 21, 2020, in PCT/US2020/036494, 5 pages. [cited by applicant]
Yazaki et al., “Expressions of Recombinant Antibodies in Mammalian Cell lines”, Antibody Engineering Methods and Protocols, Methods in Molecular Biology, vol. 248, 2004, pp. 255-268. [cited by applicant]
Yeung et al., “A Therapeutic Anti-VEGF Antibody with Increased Potency Independent of Pharmacokinetic Half-life”, Cancer Research, vol. 70, No. 8, Apr. 15, 2010, pp. 3269-3277. [cited by applicant]
Zalevsky et al., “Enhanced antibody half-life improves in vivo activity”, Nat. Biotechnol., vol. 28, No. 2, Feb. 2010, pp. 157-159. [cited by applicant]
Zambrano-Zaragoza et al., “Th17 Cells in Autoimmune and Infectious Diseases”, International Journal of Inflammation, Article ID 651503, Aug. 3, 2014, pp. 1-12. [cited by applicant]
Zanotti et al., “Synthesis of analogues of amaninamide, an amatoxin from the white Amanita virosa mushroom”, Int. J. Peptide Protein Res., vol. 30, Jan. 30, 1987, pp. 450-459. [cited by applicant]
U.S. Appl. No. 17/457,607, filed Dec. 3, 2021, Patent Publication No. 2022/0249683, Boitano et al. [cited by applicant]