IP Library Granted Patent US 12,448,463
Granted Patent B2
US 12,448,463 · App. 17/541,837 · Granted Oct 21, 2025

Antibodies for botulinum neurotoxins

Inventors: James D. Marks (Kensington, CA); Maria Consuelo Garcia Rodriguez (San Francisco, CA)
Assignee: The Regents of the University of California
C07K16/40C07K16/1282G01N33/56911G01N33/573A61K2039/505A61K2039/507C07K2317/20C07K2317/21C07K2317/24C07K2317/33C07K2317/54C07K2317/55C07K2317/56C07K2317/565C07K2317/622C07K2317/76C07K2317/92G01N2333/33G01N2333/952
View Patent ↗
Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US 12,448,463
App. No.
17/541,837
Granted
Oct 21, 2025
Kind
B2
Abstract

The present disclosure provides antibodies that specifically bind to botulinum neurotoxins (e.g., BoNT/A, BoNT/B, BoNT/C, BoNT/D, BoNT/E, BoNT/F, BoNT/G, etc.) and the epitopes bound by those antibodies. The antibodies and derivatives thereof that specifically bind to the neutralizing epitopes provided herein can be used to neutralize botulinum neurotoxin and are therefore also useful in the treatment of botulism.

Claims (43)

1. A composition comprising:

a) a first isolated nucleic acid comprising a nucleotide sequence encoding a variable heavy chain (V H ) polypeptide comprising:

a VH CDR1 comprising the amino acid sequence of NYPMS (SEQ ID NO: 509),

a VH CDR2 comprising the amino acid sequence of SLTASGDNTFYADSVKG (SEQ ID NO: 510),

a VH CDR3 comprising the amino acid sequence of ALVGRYDISTGYYRPVMDS (SEQ ID NO: 511); and

b) a second isolated nucleic acid comprising a nucleotide sequence encoding a variable light chain (V L ) polypeptide comprising:

a VL CDR1 comprising the amino acid sequence of RASQSVSSSYLA (SEQ ID NO: 512),

a VL CDR2 comprising the amino acid sequence of GTSSRAT (SEQ ID NO: 513), and

a VL CDR3 comprising the amino acid sequence of QQYNNWPLT (SEQ ID NO 514).

2. The composition of claim 1 , wherein the first and second isolated nucleic acids are on the same nucleic acid construct.

3. An expression vector comprising the first and second isolated nucleic acids of claim 2 .

4. A cell comprising the expression vector of claim 3 .

5. The composition of claim 1 , wherein the first and second isolated nucleic acids are on different nucleic acid constructs.

6. A cell comprising the first and second isolated nucleic acids of claim 5 .

7. The cell of claim 6 , wherein the said different nucleic acid constructs are expression vectors.

8. A method of making an antibody, or antigen-binding fragment thereof, the method comprising culturing the cell of claim 6 under conditions suitable for the cell to express the antibody or antigen-binding fragment.

9. The method of claim 8 , wherein the method further comprises recovering the antibody or antigen-binding fragment from the cell culture.

10. A method of making an antibody, or antigen-binding fragment thereof, the method comprising culturing the cell of claim 4 under conditions suitable for the cell to express the antibody or antigen-binding fragment.

11. The method of claim 10 , wherein the method further comprises recovering the antibody or antigen-binding fragment from the cell culture.

12. The method of claim 11 , wherein the antibody, or antigen-binding fragment thereof, is a single chain variable fragment (scFv).

13. A composition comprising:

a) a first isolated nucleic acid comprising a nucleotide sequence encoding an amino acid sequence of a variable heavy chain (VH) polypeptide comprising the amino acid sequence of

(SEQ ID NO: 304)

EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYPMSWVRQAPGKGLEWVS

SLTASGDNTFYADSVKGRFTISRDNSKNTLYLQMHSLRAEDTAVYYCAK

ALVGRYDISTGYYRPVMDSWGQGTLVTVSS;

and

b) a second isolated nucleic acid comprising a nucleotide sequence encoding an amino acid sequence of a variable light chain (VL) polypeptide comprising the amino acid sequence of

(SEQ ID NO: 334)

EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQKKPDQAPRLLI

YGTSSRATGVTDRFTGSGSGTDFTLTISRLEPEDFAVYYCQQYNNWPLT

FGGGTKAEIKR.

14. The composition of claim 13 , wherein the first and second isolated nucleic acids are on the same nucleic acid construct.

15. A expression vector comprising the first and second isolated nucleic acids of claim 14 .

16. The composition of claim 13 , wherein the first and second isolated nucleic acids are on different nucleic acid constructs.

17. A cell comprising the first and second isolated nucleic acids of claim 16 .

18. The cell of claim 17 , wherein said different nucleic acid constructs are expression vectors.

19. A method of making an antibody or antigen-binding fragment thereof, the method comprising culturing the cell of claim 17 under conditions suitable for the cell to express the antibody or antigen-binding fragment.

20. The method of claim 19 , wherein the method further comprises recovering the antibody or antigen-binding fragment from the cell culture.

21. A cell comprising the expression vector of claim 15 .

22. A method of making an antibody, or antigen-binding fragment thereof, the method comprising culturing the cell of claim 21 under conditions suitable for the cell to express the antibody, or antigen-binding fragment thereof.

23. The method of claim 22 , wherein the method further comprises recovering the antibody or antigen-binding fragment from the cell culture.

24. The method of claim 23 , wherein the antibody, or antigen-binding fragment thereof, is a single chain variable fragment (scFv).

Assignments (1)
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded May 10, 2022
From: MARKS, JAMES D.; FAN, YONGFENG; LOU, JIANLONG; CONSUELO GARCIA RODRIGUEZ, MARIA; YAN, SHUDE; GEREN, ISIN NEGRIZ; ZHAI, WENWU; CHAKRABORTI, SUBHENDU
To: THE REGENTS OF THE UNIVERSITY OF CALIFORNIA
Reel/Frame 059880/0658 →
Continuity (7)
Continuation 16813161 · Mar 9, 2020
Continuation 15870635 · Jan 12, 2018
Division 14966959 · Dec 11, 2015
Continuation 13813623
Provisional Application 61430084 · Jan 5, 2011
Provisional Application 61378862 · Aug 31, 2010
Related Publication 20220089784A1 · Mar 24, 2022
References Cited (269)
US 4689299A · Insel et al. · 1987 [cited by applicant]
US 5231003A · Coughlin et al. · 1993 [cited by applicant]
US 5306730A · Nagai et al. · 1994 [cited by applicant]
US 5599539A · Carroll et al. · 1997 [cited by applicant]
US 5719267A · Carroll et al. · 1998 [cited by applicant]
US 5731161A · Aoki et al. · 1998 [cited by applicant]
US 5807741A · Brown et al. · 1998 [cited by applicant]
US 5919665A · Williams · 1999 [cited by applicant]
US 5932449A · Emanuel et al. · 1999 [cited by applicant]
US 6331402B1 · Nussbaum et al. · 2001 [cited by applicant]
US 6416947B1 · Balasubramanian et al. · 2002 [cited by applicant]
US 6461617B1 · Shone et al. · 2002 [cited by applicant]
US 6495143B2 · Lee et al. · 2002 [cited by applicant]
US 6656468B1 · Carroll et al. · 2003 [cited by applicant]
US 6667158B1 · Bavari et al. · 2003 [cited by applicant]
US 6730324B2 · Troczynski et al. · 2004 [cited by applicant]
US 6762280B2 · Schmidt et al. · 2004 [cited by applicant]
US 6794128B2 · Marks et al. · 2004 [cited by applicant]
US 6841156B2 · Aoki et al. · 2005 [cited by applicant]
US 6932449B2 · Collins et al. · 2005 [cited by applicant]
US 7049085B2 · Bavari et al. · 2006 [cited by applicant]
US 7081529B2 · Smith et al. · 2006 [cited by applicant]
US 7157562B1 · Olsen, II et al. · 2007 [cited by applicant]
US 7192596B2 · Shone et al. · 2007 [cited by applicant]
US 7214787B1 · Smith et al. · 2007 [cited by applicant]
US 7244826B1 · Marks et al. · 2007 [cited by applicant]
US 7332580B2 · Adams et al. · 2008 [cited by applicant]
US 7332585B2 · Adams et al. · 2008 [cited by applicant]
US 7341843B2 · Atassi · 2008 [cited by applicant]
US 7563874B2 · Marks et al. · 2009 [cited by applicant]
US 7700738B2 · Marks et al. · 2010 [cited by applicant]
US 7999079B2 · Marks et al. · 2011 [cited by applicant]
US 8198034B2 · Fernandez-Salas et al. · 2012 [cited by applicant]
US 8263747B2 · Marks et al. · 2012 [cited by applicant]
US 8299218B2 · Marks et al. · 2012 [cited by applicant]
US 8329873B2 · Adams et al. · 2012 [cited by applicant]
US 8476024B2 · Mahrhold et al. · 2013 [cited by applicant]
US 8598321B2 · Marks et al. · 2013 [cited by applicant]
US 8618261B2 · Ester et al. · 2013 [cited by applicant]
US 8821879B2 · Babuka · 2014 [cited by applicant]
US 8974792B2 · Marks et al. · 2015 [cited by applicant]
US 9000131B2 · Marks et al. · 2015 [cited by applicant]
US 9023352B2 · Shoemaker et al. · 2015 [cited by applicant]
US 9181330B2 · Marks et al. · 2015 [cited by applicant]
US 9220772B2 · Zhou · 2015 [cited by applicant]
US 9243057B2 · Marks et al. · 2016 [cited by applicant]
US 9249216B2 · Fernandez-Salas et al. · 2016 [cited by applicant]
US 9273057B2 · Purandare et al. · 2016 [cited by applicant]
US 9453068B2 · Marks et al. · 2016 [cited by applicant]
US 9456068B2 · Dhawan et al. · 2016 [cited by applicant]
US 9593162B2 · Liu et al. · 2017 [cited by applicant]
US 9834616B2 · Shoemaker · 2017 [cited by applicant]
US 9902780B2 · Marks et al. · 2018 [cited by applicant]
US 9902781B2 · Marks et al. · 2018 [cited by applicant]
US 10308708B2 · Marks et al. · 2019 [cited by applicant]
US 10611851B2 · Marks et al. · 2020 [cited by applicant]
US 10618972B2 · Marks et al. · 2020 [cited by applicant]
US 10927165B2 · Marks et al. · 2021 [cited by applicant]
US 20020155114A1 · Marks et al. · 2002 [cited by applicant]
US 20040009172A1 · Fischkoff et al. · 2004 [cited by applicant]
US 20040137601A1 · Von Eichel-Streiber et al. · 2004 [cited by applicant]
US 20040175385A1 · Marks et al. · 2004 [cited by applicant]
US 20040265935A1 · Atassi · 2004 [cited by applicant]
US 20050147610A1 · Ghayur · 2005 [cited by applicant]
US 20060147471A1 · Borodic et al. · 2006 [cited by applicant]
US 20060177881A1 · Bavari et al. · 2006 [cited by applicant]
US 20060246071A1 · Green et al. · 2006 [cited by applicant]
US 20060251658A1 · Ledbetter et al. · 2006 [cited by applicant]
US 20080124328A1 · Marks · 2008 [cited by applicant]
US 20080125328A1 · Wyrick et al. · 2008 [cited by applicant]
US 20090117587A1 · Stanker et al. · 2009 [cited by applicant]
US 20090123481A1 · Marks et al. · 2009 [cited by applicant]
US 20090324606A1 · Marks et al. · 2009 [cited by applicant]
US 20100150934A1 · Pomato et al. · 2010 [cited by applicant]
US 20100166773A1 · Marks et al. · 2010 [cited by applicant]
US 20100222555A1 · Dessain et al. · 2010 [cited by applicant]
US 20110059079A1 · Babuka et al. · 2011 [cited by applicant]
US 20110171235A1 · Marks et al. · 2011 [cited by applicant]
US 20110200615A1 · Marks et al. · 2011 [cited by applicant]
US 20120121581A1 · Babuka et al. · 2012 [cited by applicant]
US 20120177663A1 · Marks et al. · 2012 [cited by applicant]
US 20120225436A1 · Fernandez-Salas et al. · 2012 [cited by applicant]
US 20130040368A1 · Fernandez-Salas et al. · 2013 [cited by applicant]
US 20140105910A1 · Marks et al. · 2014 [cited by applicant]
US 20150030600A1 · Marks et al. · 2015 [cited by applicant]
US 20150197559A1 · Marks et al. · 2015 [cited by applicant]
US 20150308988A1 · Babuka et al. · 2015 [cited by applicant]
US 20160031971A9 · Shoemaker · 2016 [cited by applicant]
US 20160168265A1 · Marks et al. · 2016 [cited by applicant]
US 20160229921A1 · Marks et al. · 2016 [cited by applicant]
US 20160362501A1 · Shoemaker et al. · 2016 [cited by applicant]
US 20170009647A1 · Koci · 2017 [cited by applicant]
US 20170096474A1 · Marks · 2017 [cited by applicant]
US 20180208679A1 · Marks et al. · 2018 [cited by applicant]
US 20180208680A1 · Marks et al. · 2018 [cited by applicant]
US 20190375828A1 · Marks et al. · 2019 [cited by applicant]
US 20200325247A1 · Marks et al. · 2020 [cited by applicant]
EP 0578515 · 1994 [cited by applicant]
WO WO1994010332 · 1994 [cited by applicant]
WO WO1996025669 · 1996 [cited by applicant]
WO WO1999056129 · 1999 [cited by applicant]
WO WO2000069891 · 2000 [cited by applicant]
WO WO2000069895 · 2000 [cited by applicant]
WO WO2001019992 · 2001 [cited by applicant]
WO WO2003057857 · 2003 [cited by applicant]
WO WO2004106376 · 2004 [cited by applicant]
WO WO2005084361 · 2005 [cited by applicant]
WO WO2005118635 · 2005 [cited by applicant]
WO WO2006124269 · 2006 [cited by applicant]
WO WO2007094754 · 2007 [cited by applicant]
WO WO2008097866 · 2008 [cited by applicant]
WO WO2009008916 · 2009 [cited by applicant]
WO WO2009105150 · 2009 [cited by applicant]
WO WO2009131605 · 2009 [cited by applicant]
WO WO2010004434 · 2010 [cited by applicant]
WO WO2010014854 · 2010 [cited by applicant]
WO WO2010014854A2 · 2010 [cited by examiner]
WO WO2011028691 · 2011 [cited by applicant]
WO WO2011028961 · 2011 [cited by applicant]
WO WO2011028962 · 2011 [cited by applicant]
WO WO2012047427 · 2012 [cited by applicant]
WO WO2020118136 · 2020 [cited by applicant]
Frenzel et al. Expression of recombinant antibodies. Frontiers in Immuno. 2013, vol. 4, 217 pp. 1-20. https://doi.org/10.3389/fimmu.2013.00217 (Year: 2013). [cited by examiner]
Costa et al. Guidelines to cell engineering for monoclonal antibody production. European Journal of Pharmaceutics and Biopharmaceutics 74 (2010) 127-138. https://doi.org/10.1016/j.ejpb.2009.10.002 (Year: 2010). [cited by examiner]
U.S. Appl. No. 13/614,771, filed Sep. 13, 2012, Marks et al. [cited by applicant]
Almagro et al. (2008), “Humanization of Antibodies,” Frontiers in Bioscience, 13:1619-1633. [cited by applicant]
Almagro et al., (2018) “Progress and Challenges in the Design and Clinical Development of Antibodies for Cancer Therapy”, Frontiers in Immunology, 8(1751):1-19. [cited by applicant]
Almquist et al. (2006) “Expression of an anti-botulinum toxin A neutralizing single-chain Fv recombinant antibody in transgenic tobacco” Vaccine 24(12):2079-2086. [cited by applicant]
Amersdorfer & Marks (2000) “Phage libraries for generation of anti-botulinum scFv antibodies” Meth. Mol. Biol. 145:219-240. [cited by applicant]
Amersdorfer (1997) “Molecular Characterization of Murine Humoral Immune Response to Botulinum Neurotoxin Type A Binding Domain as Assessed by Using Phage Antibody Libraries” Infect. Immun. 65(9):3743-3752. [cited by applicant]
Amersdorfer et al. (2002) “Genetic and Immunological Comparison of Anti-Botulinum Type A Antibodies from Immune and Non-Immune Human Phage Libraries” Vaccine 20(11-12):1640-1648. [cited by applicant]
Arndt et al. (2005) “The structure of the neurotoxin-associated protein HA33A from Clostridium botulinum suggests a reoccurring beta-trefoil fold in the progenitor toxin complex” J. Mol. Biol. 346(4):1083-1093. [cited by applicant]
Arnon (1993) “Clinical Trial of Human Botulism” Botulinum and Tetanus Neurotoxins: Neurotransmission and Biomedical Aspects ed. DasGupta B. R. Plenum New York. pp. 477-482. [cited by applicant]
Arnon et al. (2001) “Botulinum toxin as a biological weapon: medical and public health management” JAMA 285(8):1059-1070. [cited by applicant]
Atassi et al. (1996) “Mapping of the Antibody-Binding Regions on Botulinum Neurotoxin H-Chain Domain 855-1296 with Antitoxin Antibodies from Three Host Species” J. Protein Chem. 15(7):691-699. [cited by applicant]
Baldwin et al. (2005) “Characterization of the antibody response to the receptor binding domain of botulinum neurotoxin serotypes A and E” Infect. Immun. 73(10):6998-7005. [cited by applicant]
Bartels et al. (1994) “Specific Antibodies against the Zn(2+)-Binding Domain of Clostridial Neurotoxins Restore Exocytosis in Chromaffin Cells Treated with Tetanus or Botulinum A Neurotoxin” J Biol Chem 269(11):8122-812… [cited by applicant]
Bavari et al. (1998) “Identifying the principal protective antigenic determinants of type A botulinum neurotoxin” Vaccine 16(19):1850-1856. [cited by applicant]
Bendig (1995) “Humanization of Rodent Monoclonal Antibodies by CDR Grafting” Methods: Companion to Methods in Enzymology 8:83-93. [cited by applicant]
Berzofsky et al. (1993) “Immunogenicity and Antigen Structure” Fundamental Immunology 3rd edition Ed. William E. Paul Chapter 8 p. 242. [cited by applicant]
Black & Dolly (1986) “Interaction of 125I-labeled botulinum neurotoxins with nerve terminals. I. Ultrastructural autoradiographic localization and quantitation of distinct membrane acceptors for types A and B on motor n… [cited by applicant]
Black & Gunn (1980) “Hypersensitivity reactions associated with botulinal antitoxin” Am. J. Med. 69(4): 567-570. [cited by applicant]
Boder et al. (2000) “Directed Evolution of Antibody Fragments withMonovalent Femtomolar Antigen-Binding Affinity” PNAS USA 97(20):10701-10705. [cited by applicant]
Boles et al. (2006) “Recombinant C Fragment of Botulinum Neurotoxin B Serotype (rBoNTB (HC)) Immune Response and Protection in the Rhesus Monkey” Toxicon 47(8):877-884. [cited by applicant]
Borras et al. (2010), “Genetic approach for the generation of stable humanized single-chain Fv fragments from rabbit monoclonal antibodies,” J. of Biol. Chem., 285(12):9054-9066. [cited by applicant]
Bowmer (1963) “Preparation and Assay of the International Standards for Clostridium botulinum Types A B C D and E Antitoxins” Bull. World Health Organ. 29:701-709. [cited by applicant]
Brown et al. (1997) “Identification and Characterization of a Neutralizing Monoclonal Antibody against Botulinum Neurotoxin Serotype F Following Vaccination with Active Toxin” Hybridoma 16(5):447-456. [cited by applicant]
Byrne & Smith (2000) “Development of vaccines for prevention of botulism” Biochimie 82(9-10): 955-966. [cited by applicant]
Caldas et al, (2003), “Humanization of the anti-CD18 antibody 6.7: an unexpected effect of a framework residue in binding to antigen”, Molecular Immunology, 39(15):941-952. [cited by applicant]
Casadevall et al., (2012) “Immunoglobulin isotype influences affinity and specificity”, Proceedings of the National Academy of Sciences of the United States of America, 109(31):12272-12273. [cited by applicant]
Casset et al. (2003) “A peptide mimetic of an anti-CD4 monoclonal antibody by rational design” Biochem Biophys. Res Comm. 307(1):198-205. [cited by applicant]
Caton et al. (1986) “Structural and functional implications of a restricted antibody response to a defined antigenic region on the influenza virus hemagglutinin” Embo J. 5(7):1577-1587. [cited by applicant]
Cenci Di Bello et al. (1994) “Antagonism of the Intracellular Action of Botulinum Neurotoxin Type A with Monoclonal Antibodies That Map to Light-Chain Epitopes” Eur. J. Biochem. 219(1-2):161-169. [cited by applicant]
Chen et al. (1997) “Antibody Mapping to Domains of Botulinum Neurotoxin Serotype A in the Complexed and Uncomplexed Forms” Infect. Immun. 65(5):1626-1630. [cited by applicant]
Chen et al. (1998) “Biophysical characterization of the stability of the 150-kilodalton botulinum toxin the nontoxic component and the 900-kilodalton botulinum toxin complex species” Infect. Immun. 66(6):2420-2425. [cited by applicant]
Chien et al., (1989) “Significant structural and functional change of an antigen-binding site by a distant amino acid substitution: proposal of a structural mechanism”, Proceedings of the National Academy of Sciences of… [cited by applicant]
Colcher et al. (1990) “In vivo tumor targeting of a recombinant single-chain antigen-binding protein” J. Natl. Cancer Inst. 82(14):1191-1197. [cited by applicant]
Coleman et al. (2004) “Methods: Recombinant DNA Technology” FASEB Journal 18(8):Suppl. S:C174 Meeting abstract Abstract Only. [cited by applicant]
Colman (1994) “Effects of Amino Acid Sequence Changes on Antibody-Antigen Interactions” Res. Immunol. 145(1):33-36. [cited by applicant]
Daniels-Holgate & Dolly (1996) “Productive and non-productive binding of botulinum neurotoxin A to motor nerve endings are distinguished by its heavy chain” J. Neurosci. Res. 44(3):263-271. [cited by applicant]
Dixit et al. (2005) “Characterization of [cited by applicant]
Dixit et al. (2006) Development of an immunodetection test for a botulinum-like neurotoxin produced by [cited by applicant]
Doellgast et al. (1993) “Sensitive enzyme-linked immunosorbent assay for detection of Clostridium botulinum neurotoxins A B and E using signal amplification via enzyme-linked coagulation assay” J. Clin. Microbiol. 31(9)… [cited by applicant]
Doellgast et al. (1997) “Sensitive assay for measurement of antibodies to Clostridium botulinum neurotoxins A B and E: use of hapten-labeled-antibody elution to isolate specific complexes” J. Clin. Microbiol. 35(3):578-… [cited by applicant]
Dolimbek et al. (2008) “Immune recognition of botulinum neurotoxin B: Antibody binding regions on the heavy chain of the toxin” Mol. Immunol. 45(4):910-924. [cited by applicant]
Dolly et al. (1984) “Acceptors for botulinum neurotoxin reside on motor nerve terminals and mediate its internalization” Nature (London) 307(5950):457-460. [cited by applicant]
Dong et al. (2010) “A Single-Domain Llama Antibody Potently Inhibits the Enzymatic Activity of Botulinum Neurotoxin by Binding to the Non-Catalytic Alpha-Exosite Binding Region” J Mol Biol 397(4):1106-1118. [cited by applicant]
Emanuel et al. (1996) “Directing antigen specificity towards botulinum neurotoxin with combinatorial phage display libraries” J. Immunol. Meth. 193(2):189-197. [cited by applicant]
Emanuel et al. (2000) “Recombinant antibodies: a new reagent for biological agent detection” Biosen. Bioelectron. 14(10-11):751-759. [cited by applicant]
Ferreira et al. (1987) “Monoclonal Antibody for the Detection of Clostridium botulinum Type A toxin” Mol. Cell Probes 1(4):337-345. [cited by applicant]
Ferreira et al. (1990) “Monoclonal antibody to type F Clostridium botulinum toxin” Appl. Environ Microbiol. 56(3):808-811. [cited by applicant]
Fitzsimmons et al. (2000) “Inhibition of tetanus toxin fragment C binding to ganglioside G(T1b) by monoclonal antibodies recognizing different epitopes” Vaccine 19(1):114-121. [cited by applicant]
Foote & Milstein (1991) “Kinetic maturation of an immune response” Nature 352(6335):530-532. [cited by applicant]
Fotinou et al. (2001) “The crystal structure of tetanus toxin Hc fragment complexed with a synthetic GT1b analogue suggests cross-linking between ganglioside receptors and the toxin” J. Biol. Chem. 276(34):32274-32281. [cited by applicant]
Franz et al. (1993) “Efficacy of Prophylactic and Therapeutic Administration of Antitoxin for Inhalation Botulism” Botulinum and Tetanus Neurotoxins: Neurotransmission and Biomedical Aspects ed. DasGupta B. R. Plenum Ne… [cited by applicant]
Garcia et al. (2013) “Human monoclonal antibodies binding botulinum neurotoxin types C D and mosaic neurotoxins C-D and D-C” Abstracts Toxins 2011 I Toxicon 68:86-87. abstract only. [cited by applicant]
Garcia-Rodriguez et al. (2007) “Molecular evolution of antibody specificity and cross reactivity for type A botulinum neurotoxins” Nature Biotech. 25(1):107-116. [cited by applicant]
Garcia-Rodriguez et al. (2011) “Neutralizing human monoclonal antibodies binding multiple serotypes of botulinum neurotoxin”, Protein Engineering Design and Selection, 24/3:321-331. [cited by applicant]
Gessler et al. (2005) “Sensitive Detection of Botulinum Neurotoxin Types C and D with an Immunoaffinity Chromatographic Column Test” Applied and Environmental Microbiology. 71(12):7897-7903. [cited by applicant]
Gibson et al. (1988) “Evaluation of a monoclonal antibody-based immunoassay for detecting type B Clostridium botulinum toxin produced in pure culture and an inoculated model cured meat system” J. Appl. Bacterial. 64(4):… [cited by applicant]
Gill (1982) “Bacterial Toxins: A Table of Lethal Amounts” Mol. Biol. Rev. 46(1):86-94. [cited by applicant]
Gilsdorf et al. (2006) “Expression Purification and Characterization of Clostridium Botulinum Type B Light Chain” Protein Expr Purif 46(2):256-267. [cited by applicant]
Giusti et al., (1987) “Somatic diversification of S107 from an antiphosphocholine to an anti-DNA autoantibody is due to a single base change in its heavy chain variable region”, Proceedings of the National Academy of Sc… [cited by applicant]
Goldman et al. (2008) “Thermostable Llama Single Domain Antibodies for Detection of Botulinum A Neurotoxin Complex” Anal Chem 80(22):8583-8591. [cited by applicant]
Gonzales et al. (2005) “Minimizing the Immunogenicity of Antibodies for Clinical Application” Tumour Biol. 26(1):31-43. [cited by applicant]
Gray et al., (2011) “Synergistic capture of Clostridium botulinum type A neurotoxin by scFv antibodies to novel epitopes”, Biotechnology and Bioengineering,108(10):2456-2467. [cited by applicant]
Greenspan et al., (1999) “Defining epitopes: It's not as easy as it seems”, Nature Biotechnology, 17(10):936-937. [cited by applicant]
Hall (2004) “Novel Application of an In Vitro Technique to the Detection and Quantification of Botulinum Neurotoxin Antibodies” J. Immunol. Methods 288(1-2):55-60. [cited by applicant]
Hallis et al. (1993) “Characterization of Monoclonal Antibodies to Botulinum” Botulinum and Tetanus Neurotoxins: Neurotransmission and Biomedical Aspects ed. DasGupta B. R. Plenum New York. pp. 433-436. [cited by applicant]
Hathaway et al. (1984) “Antitoxin levels in botulism patients treated with trivalent equine botulism antitoxin to toxin types A B and E” J. Infect. Dis. 150(3):407-412. [cited by applicant]
Hatheway & Dang (1994) “Immunogenicity of the Neurotoxins of Clostridium botulinum” Therapy with Botulinum Toxin ed. Jankovic & Hallet Marcel Dekker New York pp. 93-107. [cited by applicant]
Hatheway (1995) “Botulism: the present status of the disease” Curr Top. Microbiol. Immunol 195:55-75. [cited by applicant]
Hibbs et al. (1996) “Experience with the use of an investigational F(ab')2 heptavalent botulism immune globulin of equine origin during an outbreak of type E botulism in Egypt” Clin. Infect. Dis. 23(2):337-340. [cited by applicant]
Hildebrand & Archer (1961) “Evidence Concerning Liquid Structure” PNAS USA 47(12):1881-1882. [cited by applicant]
Hildebrand et al. (1961) “Distribution and Particle Size of Type A Botulinum Toxin in Body Fluids of Intravenously Injected Rabbits” Proc. Soc. Exp. Biol. Med. 107(2):284-289. [cited by applicant]
Huston et al. (1996) “Single-chain Fv radioimmunotargeting” Q. J. Nucl. Med. 40(3):320-333. [cited by applicant]
Jung & Plückthun (1997) “Improving In Vivo Folding and Stability of a Single-Chain Fv Antibody Fragment by Loop Grafting” Protein Eng. 10(8):959-66. [cited by applicant]
Koriazova & Montal (2003) “Translocation of botulinum neurotoxin light chain protease through the heavy chain channel” Nat. Struct. Biol. 10(1):13-18. [cited by applicant]
Kozaki et al. (1986) “The use of monoclonal antibodies to analyze the structure of Clostridium botulinum type E derivative toxin” Infect Immun. 52(3):786-791. [cited by applicant]
Kozaki et al. (1995) “Immunological characterization of the neurotoxin produced by Clostridium botulinum type A associated with infant botulism in Japan” Microbiol. Immunol. 39(10):767-774. [cited by applicant]
Kozaki et al. (1998) “Characterization of Clostridium botulinum type B neurotoxin associated with infant botulism in japan” Infect. Immun. 66(10):4811-4816. [cited by applicant]
Lacy & Stevens (1999) “Sequence homology and structural analysis of the clostridial neurotoxins” J. Mol. Biol. 291(5):1091-1104. [cited by applicant]
Lacy et al. (1998) “Crystal structure of botulinum neurotoxin type A and implications for toxicity” Nat. Struct. Biol. 5(10): 898-902. [cited by applicant]
Lang et al. (1993) “Immunotherapy with human monoclonal antibodies. Fragment A specificity of polyclonal and monoclonal antibodies is crucial for full protection against tetanus toxin” J. Immunol. 151(13):466-472. [cited by applicant]
Lebecque & Gearhart (1990) “Boundaries of somatic mutation in rearranged immunoglobulin genes: 5′ boundary is near the promoter and 3′ boundary is approximately 1 kb from V(D)J gene” J. Exp. Med. 172(6):1717-1727. [cited by applicant]
Lee et al. (2008) “Production and characterization of monoclonal antibody to botulinum neurotoxin type B light chain by phage display” Hybridoma (Larchmt) 27(1):18-24. [cited by applicant]
Levy et al. (1989) “Early onset of somatic mutation in immunoglobulin VH genes during the primary immune response” J. Exp. Med. 169(6):2007-2019. [cited by applicant]
Levy et al. (2007) “Fine and domain-level epitope mapping of botulinum neurotoxin type A neutralizing antibodies by yeast surface display” J. Mol. Biol. 365(1):196-210. [cited by applicant]
Lipps & Khan (2000) “Antigenic cross reactivity among the venoms and toxins from unrelated diverse sources” Toxicon. 38(7):973-980. [cited by applicant]
Liu et al. (2007) “Isolation of Anti-Toxin Single Domain Antibodies from a Semi-Synthetic Spiny Dogfish Shark Display Library” BMC Biotechnol 7:78. [cited by applicant]
Lou et al., Abstracts/Toxicon 93 (2015).pp. S40-S41. abstract# 131 (Year: 2015). [cited by applicant]
Maccallum et al. (1996) “Antibody-antigen Interactions: Contact Analysis and Binding Site Topography” J. Mol. Biol. 262(5):732-45. [cited by applicant]
Mah et al. (2003) “Recombinant anti-botulinum neurotoxin A single-chain variable fragment antibody generated using a phage display system” Hybrid Hybridomics. 22(5):277-283. [cited by applicant]
Mahant et al. (2000) “The current use of botulinum toxin” J. Clin. Neurosci. 7(5):389-394. [cited by applicant]
Marchev & Marcheva (1982) “[Production of MonoSpecific Type A Botulinum Toxin and Antiserum Using a Column Chromatographic Method]” Vet. Med. Nauki. 19(1):57-63. [cited by applicant]
Marks (2004) “Deciphering antibody properties that lead to potent botulinum neurotoxin neutralization” Mov. Disord. 19(Suppl. 8):S101-S108. [cited by applicant]
McHeyzer-Williams (1993) “B Lymphocyte Biology” Fundamental Immunology 3rd Edition Ed. William E. Paul Raven Press: NY Chapter 9 pp. 292-295. [cited by applicant]
McKean et al. (1978) “Mechanisms of antibody diversity: multiple genes encode structurally related mouse κ variable regions” PNAS USA 75(8):3913-3917. [cited by applicant]
Meng et al. (2012) “Engineered domain-based assays to identify individual antibodies in oligoclonal combinations targeting the same protein” Anal Biochem 430(2):141-150. [cited by applicant]
Middlebrook & Brown (1995) “Immunodiagnosis and immunotherapy of tetanus and botulinum neurotoxins” Curr. Top. Microbiol. Immunol. 195:89-122. [cited by applicant]
Middlebrook & Franz (1997) “Botulinum Toxins” Medical Aspects of Chemical and Biological Warfare Ed. Sidell et al. TMM publications Washington D.C. Chapter 33 pp. 643-654. [cited by applicant]
Montecucco & Schiavo (1995) “Structure and function of tetanus and botulinum neurotoxins” Q. Rev. Biophys. 28(4):423-472. [cited by applicant]
Montecucco (1986) “How do Tetanus and Botulinum Toxins Bind to Neuronal Membranes?” Trends Biochem. Sci. 11(8):314-317. [cited by applicant]
Montero-Julian et al. (1995) “Pharmacokinetic study of anti-interleukin-6 (IL-6) therapy with monoclonal antibodies: enhancement of IL-6 clearance by cocktails of anti-IL-6 antibodies” Blood 85(4): 917-924. [cited by applicant]
Mowry et al. (2004) “Production and purification of a chimeric monoclonal antibody against botulinum neurotoxin serotype A” Protein Expr. Purif. 37(2):399-408. [cited by applicant]
Mullaney et al. (2001) “Epitope Mapping of Neutralizing Botulinum Neurotoxin A Antibodies by Ohage Display” Infect. Immun. 69(10):6511-6514. [cited by applicant]
Noah et al. (1995) “Production of Monoclonal Antibodies Specific to Clostridium botulinum Type B Neurotoxin” J. AOAC Int. 78(2):381-385. [cited by applicant]
Nowakowski et al. “Potent Neutralization of Botulinum Neurotoxin by Recombinant Oligoclonal Antibody” PNAS USA 99(17):11346-11350. [cited by applicant]
O'Connell et al. (2007) “Production of a recombinant antibody fragment in whole insect larvae” Mol Biotechnol. 36(1): 44-51. [cited by applicant]
Oguma et al. (1982) “Four different monoclonal antibodies against type C1 toxin of Clostridium botulinum” Infect. Immun. 38(1):14-20. [cited by applicant]
Oguma et al. (1984) “Analysis of antigenicity of Clostridium botulinum type C1 and D toxins by polyclonal and monoclonal antibodies” Infect Immun. 43(2):584-588. [cited by applicant]
Oguma et al. (1990) “Infant botulism due to Clostridium botulinum type C toxin” Lancet 336(8728):1449-1450. [cited by applicant]
Oshima (1997) “Immune Recognition of Botulinum Neurotoxin Type A: Regions Recognized by T cells and Antibodies against the Protective H(C) Fragment (residues 855-1296) of Toxin” Mol. Immunol. 34(14):1031-1040. [cited by applicant]
Padlan et al. (1989) “Structure of an antibody-antigen complex: crystal structure of the HyHEL-10 Fab-lysozyme complex” Proc Natl Acad Sci USA 86:5938-5942. [cited by applicant]
Palys et al. (2006) “Conversion of a mouse Fab into a whole humanized IgG antibody for detecting botulinum toxin” Hum Antibodies 15(4):125-132. [cited by applicant]
Park et al. (2003) “Immunologic characterization of spasmodic dysphonia patients who develop resistance to botulinum toxin” J. Voice. 17(2):255-264. [cited by applicant]
Paul, Wlilliam, E. (1993) “Fundamental Immunology” Raven Press 9:292-295. [cited by applicant]
Pless et al. (2001) “High-affinity protective antibodies to the binding domain of botulinum neurotoxin type A” Infect. Immun. 69(1):570-574. [cited by applicant]
Prezedpelski et al. (2013) “Enhancing the Protective Immune Response against Botulism” Infection and Immunity 81(7):2638-2644. [cited by applicant]
Razai et al. (2005) “Molecular evolution of antibody affinity for sensitive detection and neutralization of botulinum neurotoxin type A” J. Mol. Biol. 351(1):158-169. [cited by applicant]
Reichert (2001) “Monoclonal antibodies in the clinic” Nat. Biotechnol. 19(9):819-822. [cited by applicant]
Rudikoff et al. (1982) “Single Amino Acid Substitution Altering Antigen-Binding Specificity” PNAS USA 79(6):1979-1983. [cited by applicant]
Schengrund (1999) “What is the Cell Surface Receptor(s) for the Different Serotypes of Botulinum Neurotoxin?” J Toxicol.—Toxin Rev. 18(1):35-44. [cited by applicant]
Schiavo et al. (1992) “Tetanus and botulinum-B neurotoxins block neurotransmitter release by proteolytic cleavage of synaptobrevin” Nature (London) 359(6398):832-835. [cited by applicant]
Schiavo et al. (1993) “Identification of the nerve terminal targets of botulinum neurotoxin serotypes A D and E” J. Biol. Chem. 268(32):23784-23787. [cited by applicant]
Schier et al. (1995) “In vitro and in vivo characterization of a human anti-c-erbB-2 single-chain Fv isolated from a filamentous phage antibody library” Immunotechnology 1(1):73-81. [cited by applicant]
Schier et al. (1996) “Isolation of picomolar affinity anti-c-erbB-2 single-chain Fv by molecular evolution of the complementarity determining regions in the center of the antibody binding site” J. Mol. Biol. 263(4):551-… [cited by applicant]
Schmidt & Stafford (2005) “Botulinum neurotoxin serotype F: identification of substrate recognition requirements and development of inhibitors with low nanomolar affinity” Biochemistry 44(10):4067-4073. [cited by applicant]
Scotcher et al. (2009) “Characterization of the Epitope Region of F1-2 and F1-5 Two Monoclonal Antibodies to Botulinum Neurotoxin Type A” Hybridoma 28(5):315-325. [cited by applicant]
Sharma et al. (2006) “Detection of type A B E and F Clostridium botulinum neurotoxins in foods by using an amplified enzyme-linked immunosorbent assay with digoxigenin-labeled antibodies” Appl Environ. Microbiol. 72(2):… [cited by applicant]
Shone et al. (1985) “Monoclonal antibody-based immunoassay for type A Clostridium botulinum toxin is comparable to the mouse bioassay” Appl Environ Microbiol. 50(1):63-67. [cited by applicant]
Siegel (1988) “Human immune response to botulinum pentavalent (ABCDE) toxoid determined by a neutralization test and by an enzyme-linked immunosorbent assay” J. Clin. Microbiol. 26(11):2351-2356. [cited by applicant]
Simpson (1980) “Kinetic studies on the interaction between botulinum toxin type A and the cholinergic neuromuscular junction” J. Pharmacol. Exp. Ther. 212(1):16-21. [cited by applicant]
Skolnick et al., (2000) “From genes to protein structure and function: novel applications of computational approaches in the genomic era”, Tibtech, 18(1):34-39. [cited by applicant]
Smith et al. (2005) “Sequence variation within botulinum neurotoxin serotypes impacts antibody binding and neutralization” Infect. Immun. 73(9):5450-5457. [cited by applicant]
Sonnabend et al. (1981) “Isolation of Clostridium botulinum type G and identification of type G botulinal toxin in humans: report of five sudden unexpected deaths” J. Infect. Dis. 143(1):22-27. [cited by applicant]
Stark & Caton (1991) “Antibodies that are specific for a single amino acid interchange in a protein epitope use structurally distinct variable regions” J. Exp. Med. 174(3):613-624. [cited by applicant]
Swaminathan & Eswaramoorthy (2000) “Structural Analysis of the Catalytic and Binding Sites of Clostridium Botulinum Neurotoxin B” Nat Struct Biol 7(8):693-699. [cited by applicant]
Tacket et al. (1984) “Equine antitoxin use and other factors that predict outcome in type A foodborne botulism” Am. J. Med. 76(5):794-798. [cited by applicant]
Thanongsaksrikul et al. (2010) “A V H H That Neutralizes the Zinc Metalloproteinase Activity of Botulinum Neurotoxin Type A” J Biol Chem 285(13):9657-9666. [cited by applicant]
Tsuzuki et al. (1988) “Establishment of a monoclonal antibody recognizing an antigenic site common to Clostridium botulinum type B C1 D and E toxins and tetanus toxin” Infect Immun. 56(4):898-902. [cited by applicant]
Volk et al. (1984) “Neutralization of tetanus toxin by distinct monoclonal antibodies binding to multiple epitopes on the toxin molecule” Infect. Immun. 45(3):604-609. [cited by applicant]
Weigert et al. (1978) “Rearrangement of genetic information may produce immunoglobulin diversity” Nature 276(5690):785-790. [cited by applicant]
Williams et al. (1983) “Radioiodination of botulinum neurotoxin type A with retention of biological activity and its binding to brain synaptosomes” Eur. J. Biochem. 131(2):437-445. [cited by applicant]
Winkler et al., (2000) “Changing the Antigen Binding Specificity by Single Point Mutations of an Anti-p24 (HIV-1) Antibody”, The Journal of Immunol, 165(8):4505-4514. [cited by applicant]
Wu et al. (2001) “Characterization of neutralizing antibodies and identification of neutralizing epitope mimics on the Clostridium botulinum neurotoxin type A” Appl. Environ. Microbiol. 67(7):3201-3207. [cited by applicant]
Yang et al. (2004) “Isolation and characterization of a neutralizing antibody specific to internalization domain of Clostridium botulinum neurotoxin type B” Toxicon 44(1):19-25. [cited by applicant]
Zhang et al. (2012) “Simultaneous and sensitive detection of six serotypes of botulinum neurotoxin using enzyme-linked immunosorbent assay-based protein antibody microarrays” Analytical Biochemistry 430:185-192. [cited by applicant]
Zwick et al. (2001) “Neutralization synergy of human immunodeficiency virus type 1 primary isolates by cocktails of broadly neutralizing antibodies” J. Virol. 75(24):12198-12208. [cited by applicant]