Peptides and compositions for prevention of cell adhesion and methods of using same
Compositions comprising an isolated peptide, which may for example optionally comprise a sequence consisting of SVHSFDYDWYNV, or any cyclized version thereof, and methods of using same, including for treatment of or prevention of formation of microbial biofilms and against adhesion of a cell to a surface.
1. A peptide selected from the group consisting of:
SFSQNKSVHSFDYDWYNVSDQADLKNQLGDAGYV (SEQ ID NO: 6), SVHSFDYDWYNVS (SEQ ID NO: 13), SVHSFDYDWYNVSD (SEQ ID NO: 14), KSVHSFDYDWYNVSD (SEQ ID NO: 15), SVHSFDYDWYNVSDQ (SEQ ID NO: 16), NKSVHSFDYDWYNVSDQ (SEQ ID NO: 17), NKSVHSFDYDWYNVSDQA (SEQ ID NO: 18), QNKSVHSFDYDWYNVSDQA (SEQ ID NO: 19), QNKSVHSFDYDWYNVSDQAD (SEQ ID NO: 20), SQNKSVHSFDYDWYNVSDQAD (SEQ ID NO: 21), SQNKSVHSFDYDWYNVSDQADL (SEQ ID NO: 22), FSQNKSVHSFDYDWYNVSDQADL (SEQ ID NO: 23), FSQNKSVHSFDYDWYNVSDQADLK (SEQ ID NO: 24), SFSQNKSVHSFDYDWYNVSDQADLK (SEQ ID NO: 25), SFSQNKSVHSFDYDWYNVSDQADLKN (SEQ ID NO: 3), CSFSQNKSVHSFDYDWYNVSDQADLKN (SEQ ID NO: 26) and CSFSQNKSVHSFDYDWYNVSDQADLKNC (SEQ ID NO: 1).
2. The peptide of claim 1 , wherein the peptide is cyclized.
3. The peptide of claim 1 , wherein the peptide is cyclized via a linker attached to the C and N termini.
4. The peptide of claim 1 , wherein the peptide is synthetic.
5. A composition comprising the peptide according to claim 1 , wherein the composition is devoid of cytotoxic or cytostatic activity.
6. A surface at least partially coated with a composition comprising the peptide of claim 1 .
7. The surface of claim 6 , wherein the surface is a medical device; a laboratory article; a household article; an article involved in water purification, water storage, or water delivery; or an article involved in food processing.
8. The surface of claim 7 , wherein the medical device is selected from the group consisting of artificial blood vessels, catheters and other devices for the removal or delivery of fluids to patients, artificial hearts, artificial kidneys, orthopedic pins, prosthetic joints, plates, urinary devices, ventricular or arterio-venous shunts, prostheses, breast implants, penile prostheses, vascular grafting prostheses, aneurysm repair devices, mechanical heart valves, artificial joints, artificial larynxes, otological implants, anastomotic devices, vascular catheter ports, vascular stents, clamps, embolic devices, wound drain tubes, ocular lenses, dental implants, hydrocephalus shunts, pacemakers and implantable defibrillators, needleless connectors, voice prostheses, urological tubes, biliary tubes, endotracheal tubes, peripherally insertable central venous catheters, dialysis catheters, long term tunneled central venous catheters, peripheral venous catheters, short term central venous catheters, arterial catheters, pulmonary catheters, Swan-Ganz catheters, urinary catheters, and peritoneal catheters and a contact lens.
9. The surface of claim 7 , wherein the household article is selected from the group consisting of food processing equipment for home use, materials for infant care, tampons, soap, detergents, health and skincare products, household cleaners and toilet bowls.
10. The surface of claim 7 , wherein the laboratory article is selected from the group consisting of microscopic slide, a culturing hood, and a tissue culture vessel or container.
11. The surface of claim 10 , wherein the tissue culture vessel or container is a Petri dish.
12. The surface of claim 6 , wherein the peptide is cyclized.
13. The surface of claim 12 , wherein the peptide is cyclized via a linker attached to the C and N termini.
14. The surface of claim 6 , wherein the composition is devoid of cytotoxic or cytostatic activity.
15. The surface of claim 6 , wherein coating of said peptide on said surface is provided by means of covalent attachment of said peptide to said surface.
16. The surface of claim 15 , wherein said covalent attachment of said peptide to said surface is provided by 1-ethyl-3-(-3-dimethylaminopropyl) carbodiimide hydrochloride (EDC) reaction.
17. The surface of claim 6 , wherein said peptide is present in the composition at a concentration from about 0.1 μM to about 10 μM.
18. The surface of claim 16 , wherein said peptide is attached with at least one PEG to said surface; wherein said peptide is attached with 3 PEGs to said surface; wherein said peptide is attached with 3 PEGs and a palmitic acid to said surface; or wherein said peptide is attached with a palmitic acid to said surface.
19. A medical device comprising a polymeric matrix, said polymeric matrix comprising the peptide of claim 1 .
20. The medical device of claim 19 , wherein the medical device is selected from the group consisting of artificial blood vessels, catheters and other devices for the removal or delivery of fluids to patients, artificial hearts, artificial kidneys, orthopedic pins, prosthetic joints, plates, urinary devices, ventricular or arterio-venous shunts, prostheses, breast implants, penile prostheses, vascular grafting prostheses, aneurysm repair devices, mechanical heart valves, artificial joints, artificial larynxes, otological implants, anastomotic devices, vascular catheter ports, vascular stents, clamps, embolic devices, wound drain tubes, ocular lenses, dental implants, hydrocephalus shunts, pacemakers and implantable defibrillators, needleless connectors, voice prostheses, urological tubes, biliary tubes, endotracheal tubes, peripherally-insertable central venous catheters, dialysis catheters, long term tunneled central venous catheters, peripheral venous catheters, short term central venous catheters, arterial catheters, pulmonary catheters, Swan-Ganz catheters, urinary catheters, and peritoneal catheters and a contact lens.
21. The medical device of claim 19 , wherein the peptide is cyclized.
22. The medical device of claim 21 , wherein the peptide is cyclized via a linker attached to the C and N termini.
23. The medical device of claim 19 , wherein the composition is devoid of cytotoxic or cytostatic activity.
24. The medical device of claim 19 , wherein coating of said peptide on said surface is provided by means of covalent attachment of said peptide to said surface.
25. The medical device of claim 24 , wherein said covalent attachment of said peptide to said surface is provided by 1-ethyl-3-(-3-dimethylaminopropyl) carbodiimide hydrochloride (EDC) reaction.
26. The medical device of claim 19 , wherein said peptide is present in the composition at a concentration from about 0.1 μM to about 10 μM.
27. The medical device of claim 25 , wherein said peptide is attached with at least one PEG to said surface; wherein said peptide is attached with 3 PEGs to said surface; wherein said peptide is attached with 3 PEGs and a palmitic acid to said surface; or wherein said peptide is attached with a palmitic acid to said surface.
28. A medical device at least partially coated with the peptide of claim 1 .
29. The medical device of claim 28 , wherein the medical device is selected from the group consisting of artificial blood vessels, catheters and other devices for the removal or delivery of fluids to patients, artificial hearts, artificial kidneys, orthopedic pins, prosthetic joints, plates, urinary devices, ventricular or arterio-venous shunts, prostheses, breast implants, penile prostheses, vascular grafting prostheses, aneurysm repair devices, mechanical heart valves, artificial joints, artificial larynxes, otological implants, anastomotic devices, vascular catheter ports, vascular stents, clamps, embolic devices, wound drain tubes, ocular lenses, dental implants, hydrocephalus shunts, pacemakers and implantable defibrillators, needleless connectors, voice prostheses, urological tubes, biliary tubes, endotracheal tubes, peripherally-insertable central venous catheters, dialysis catheters, long term tunneled central venous catheters, peripheral venous catheters, short term central venous catheters, arterial catheters, pulmonary catheters, Swan-Ganz catheters, urinary catheters, and peritoneal catheters and a contact lens.
30. The medical device of claim 28 , wherein the peptide is cyclized.
31. The medical device of claim 28 , wherein the peptide is cyclized via a linker attached to the C and N termini.
32. The medical device of claim 28 , wherein coating of said peptide on said surface is provided by means of covalent attachment of said peptide to said surface.
33. The medical device of claim 32 , wherein said covalent attachment of said peptide to said surface is provided by 1-ethyl-3-(-3-dimethylaminopropyl) carbodiimide hydrochloride (EDC) reaction.
34. The medical device of claim 28 , wherein said peptide is present in the composition at a concentration from about 0.1 μM to about 10 μM.
35. The medical device of claim 33 , wherein said peptide is attached with at least one PEG to said surface; wherein said peptide is attached with 3 PEGs to said surface; wherein said peptide is attached with 3 PEGs and a palmitic acid to said surface; or wherein said peptide is attached with a palmitic acid to said surface.
36. A method of preventing formation of a biofilm on a surface or in a medical device, wherein the method comprises contacting the surface or the medical device with a composition comprising the peptide of claim 1 .
37. The method of claim 36 , wherein the surface is a laboratory article; a household article; an article involved in water purification, water storage, or water delivery; or an article involved in food processing.
38. The method of claim 36 , wherein the medical device is selected from the group consisting of artificial blood vessels, catheters and other devices for the removal or delivery of fluids to patients, artificial hearts, artificial kidneys, orthopedic pins, prosthetic joints, plates, urinary devices, ventricular or arterio-venous shunts, prostheses, breast implants, penile prostheses, vascular grafting prostheses, aneurysm repair devices, mechanical heart valves, artificial joints, artificial larynxes, otological implants, anastomotic devices, vascular catheter ports, vascular stents, clamps, embolic devices, wound drain tubes, ocular lenses, dental implants, hydrocephalus shunts, pacemakers and implantable defibrillators, needleless connectors, voice prostheses, urological tubes, biliary tubes, endotracheal tubes, insertable central venous catheters, dialysis catheters, long term tunneled central venous catheters, peripheral venous catheters, short term central venous catheters, arterial catheters, pulmonary catheters, Swan-Ganz catheters, urinary catheters, and peritoneal catheters and a contact lens.
39. The method of claim 37 , wherein the household article is selected from the group consisting of food processing equipment for home use, materials for infant care, tampons, soap, detergents, health and skincare products, household cleaners and toilet bowls.
40. The method of claim 37 , wherein the laboratory article is selected from the group consisting of microscopic slide, a culturing hood, and a tissue culture vessel or container.
41. The method of claim 40 , wherein the tissue culture vessel or container is a Petri dish.
42. The method of claim 36 , wherein the surface is selected from the group consisting of ships'/boats' hulls, submergence vehicles, navigational aids, screens, nets, constructions, floating or emplaced offshore platforms, buoys, signaling equipment and articles which come into contact with sea water or salty water, pilings, marine markers, cabling, pipes, fishing nets, bulkheads, and cooling towers.
43. The method of claim 36 , wherein the peptide is cyclized.
44. The method of claim 43 , wherein the peptide is cyclized via a linker attached to the C and N termini.
45. The method of claim 36 , wherein the composition is devoid of cytotoxic or cytostatic activity.
46. The method of claim 36 , wherein said step of contacting additionally comprising coating of said peptide on said surface is provided by means of covalent attachment of said peptide to said surface.
47. The method of claim 46 , wherein said covalent attachment of said peptide to said surface is provided by 1-ethyl-3-(-3-dimethylaminopropyl) carbodiimide hydrochloride (EDC) reaction.
48. The method of claim 36 , wherein said peptide is present in the composition at a concentration from about 0.1 μM to about 10 μM.
49. The method of claim 47 , wherein said peptide is attached with at least one PEG to said surface; wherein said peptide is attached with 3 PEGs to said surface; wherein said peptide is attached with 3 PEGs and a palmitic acid to said surface; or wherein said peptide is attached with a palmitic acid to said surface.